Recombinant Human SLC66A2 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: SLC66A2-1963H
• Product Overview: PQLC1 MS Standard C13 and N15-labeled recombinant protein (NP_079354) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: SLC66A2 (Solute Carrier Family 66 Member 2) is a Protein Coding gene.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 30.5 kDa
• AA Sequence: MEAEGLDWLLVPLHQLVSWGAAAAMVFGGVVPYVPQYRDIRRTQNADGFSTYVCLVLLVANILRILFWFGRRFESPLLWQSAIMILTMLLMLKLCTEVRVANELNARRRSFTAADSKDEEVKVAPRRSFLDFDPHHFWQWSSFSDYVQCVLAFTGVAGYITYLSIDSALFVETLGFLAVLTEAMLGVPQLYRNHRHQSTEGMSIKMVLMWTSGDAFKTAYFLLKGAPLQFSVCGLLQVLVDLAILGQAYAFARHPQKPAPHAVHPTGTKALTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: SLC66A2 solute carrier family 66 member 2 [ Homo sapiens (human) ]
• Official Symbol: SLC66A2
• Synonyms: SLC66A2; solute carrier family 66 member 2; PQLC1; solute carrier family 66 member 2; PQ loop repeat containing 1; PQ-loop repeat-containing protein 1
• Gene ID: 80148
• mRNA Refseq: NM_025078
• Protein Refseq: NP_079354
• UniProt ID: Q8N2U9