Recombinant Human SLC5A1, GST-tagged
Cat.No. : | SLC5A1-2775H |
Product Overview : | Recombinant Human SLC5A1(1 a.a. - 664 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a member of the sodium-dependent glucose transporter (SGLT) family. The encoded integral membrane protein is the primary mediator of dietary glucose and galactose uptake from the intestinal lumen. Mutations in this gene have been associated with glucose-galactose malabsorption. Multiple transcript variants encoding different isoforms have been found for this gene. |
Molecular Mass : | 99.99 kDa |
AA Sequence : | MDSSTWSPKTTAVTRPVETHELIRNAADISIIVIYFVVVMAVGLWAMFSTNRGTVGGFFLAGRSMVWWPIGASLF ASNIGSGHFVGLAGTGAASGIAIGGFEWNALVLVVVLGWLFVPIYIKAGVVTMPEYLRKRFGGQRIQVYLSLLSL LLYIFTKISADIFSGAIFINLALGLNLYLAIFLLLAITALYTITGGLAAVIYTDTLQTVIMLVGSLILTGFAFHE VGGYDAFMEKYMKAIPTIVSDGNTTFQEKCYTPRADSFHIFRDPLTGDLPWPGFIFGMSILTLWYWCTDQVIVQR CLSAKNMSHVKGGCILCGYLKLMPMFIMVMPGMISRILYTEKIACVVPSECEKYCGTKVGCTNIAYPTLVVELMP NGLRGLMLSVMLASLMSSLTSIFNSASTLFTMDIYAKVRKRASEKELMIAGRLFILVLIGISIAWVPIVQSAQSG QLFDYIQSITSYLGPPIAAVFLLAIFWKRVNEPGAFWGLILGLLIGISRMITEFAYGTGSCMEPSNCPTIICGVH YLYFAIILFAISFITIVVISLLTKPIPDVHLYRLCWSLRNSKEERIDLDAEEENIQEGPKETIEIETQVPEKKKG IFRRAYDLFCGLEQHGAPKMTEEEEKAMKMKMTDTSEKPLWRTVLNVNGIILVTVAVFCHAYFA |
Applications : | ELISA; WB-Re; AP; Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | SLC5A1 solute carrier family 5 (sodium/glucose cotransporter), member 1 [ Homo sapiens (human) ] |
Official Symbol | SLC5A1 |
Synonyms | SLC5A1; solute carrier family 5 (sodium/glucose cotransporter), member 1; SGLT1; sodium/glucose cotransporter 1; D22S675; NAGT; Na+/glucose cotransporter 1; high affinity sodium-glucose cotransporter |
Gene ID | 6523 |
mRNA Refseq | NM_000343 |
Protein Refseq | NP_000334 |
MIM | 182380 |
UniProt ID | P13866 |
Chromosome Location | 22q12.3 |
Pathway | Bile secretion; Carbohydrate digestion and absorption; Hexose transport |
Function | glucose:sodium symporter activity; protein binding |
◆ Recombinant Proteins | ||
SLC5A1-8395M | Recombinant Mouse SLC5A1 Protein, His (Fc)-Avi-tagged | +Inquiry |
SLC5A1-5218R | Recombinant Rat SLC5A1 Protein, His (Fc)-Avi-tagged | +Inquiry |
SLC5A1-2776H | Recombinant SLC5A1, GST-tagged | +Inquiry |
SLC5A1-2699H | Recombinant Human SLC5A1 Protein, His-tagged | +Inquiry |
SLC5A1-5559R | Recombinant Rat SLC5A1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
SLC5A1-1710HCL | Recombinant Human SLC5A1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SLC5A1 Products
Required fields are marked with *
My Review for All SLC5A1 Products
Required fields are marked with *
0
Inquiry Basket