Recombinant Human SLC44A1 Protein, GST-Tagged

• Cat.No.: SLC44A1-1330H
• Product Overview: Human CDW92 partial ORF (NP_536856, 74 a.a. - 183 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: SLC44A1 (Solute Carrier Family 44 Member 1) is a Protein Coding gene. Diseases associated with SLC44A1 include Postural Orthostatic Tachycardia Syndrome. Among its related pathways are Transport of glucose and other sugars, bile salts and organic acids, metal ions and amine compounds and Synthesis of PC. GO annotations related to this gene include choline transmembrane transporter activity. An important paralog of this gene is SLC44A3.
• Molecular Mass: 37.84 kDa
• AA Sequence: TKLEAIPNSGMDHTQRKYVFFLDPCNLDLINRKIKSVALCVAACPRQELKTLSDVQKFAEINGSALCSYNLKPSEYTTSPKSSVLCPKLPVPASAPIPFFHRCAPVNISC
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: SLC44A1 solute carrier family 44, member 1 [ Homo sapiens ]
• Official Symbol: SLC44A1
• Synonyms: SLC44A1; solute carrier family 44, member 1; CDW92, CDW92 antigen; choline transporter-like protein 1; CD92; CDw92; CHTL1; CTL1; CDW92 antigen; CDW92; RP11-287A8.1
• Gene ID: 23446
• mRNA Refseq: NM_080546
• Protein Refseq: NP_536856
• MIM: 606105
• UniProt ID: Q8WWI5