Recombinant Human SLC39A8 protein, GST-tagged

• Cat.No.: SLC39A8-1878H
• Product Overview: Recombinant Human SLC39A8 protein(18-143 aa), fused to GST tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: GST
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH.
• Protein length: 18-143 aa
• AA Sequence: LGGVAEGPGLAFSEDVLSVFGANLSLSAAQLQHLLEQMGAASRVGVPEPGQLHFNQCLTAEEIFSLHGFSNATQITSSKFSVICPAVLQQLNFHPCEDRPKHKTRPSHSEVWGYGFLSVTIINLAS
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: SLC39A8 solute carrier family 39 (zinc transporter), member 8 [ Homo sapiens ]
• Official Symbol: SLC39A8
• Synonyms: SLC39A8; solute carrier family 39 (zinc transporter), member 8; solute carrier family 39 (metal ion transporter), member 8; zinc transporter ZIP8; BIGM103; ZIP-8; Zrt- and Irt-like protein 8; solute carrier family 39 member 8; LIV-1 subfamily of ZIP zinc transporter 6; BCG induced integral membrane protein BIGM103; BCG-induced integral membrane protein in monocyte clone 103 protein; ZIP8; PP3105; LZT-Hs6
• Gene ID: 64116
• mRNA Refseq: NM_001135146
• Protein Refseq: NP_001128618
• MIM: 608732
• UniProt ID: Q9C0K1