Recombinant Human SLC39A7 protein, His-tagged

• Cat.No.: SLC39A7-3987H
• Product Overview: Recombinant Human SLC39A7 protein(237-384 aa), fused to His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 237-384 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
• AA Sequence: VRHVKGGHGHSHGHGHAHSHTRGSHGHGRQERSTKEKQSSEEEEKETRGVQKRRGGSTVPKDGPVRPQNAEEEKRGLDLRVSGYLNLAADLAHNFTDGLAIGASFRGGRGLGILTTMTVLLHEVPHEVGDFAILVQSGCSKKQAMRLQ
• Purity: 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: SLC39A7 solute carrier family 39 (zinc transporter), member 7 [ Homo sapiens ]
• Official Symbol: SLC39A7
• Synonyms: SLC39A7; solute carrier family 39 (zinc transporter), member 7; HKE4, HLA class II region expressed gene KE4; zinc transporter SLC39A7; D6S2244E; H2 KE4; KE4; RING5; ZIP7; Ke4 gene, mouse, human homolog of; solute carrier family 39 member 7; histidine-rich membrane protein Ke4; really interesting new gene 5 protein; HLA class II region expressed gene KE4; HKE4; H2-KE4; D6S115E
• Gene ID: 7922
• mRNA Refseq: NM_001077516
• Protein Refseq: NP_001070984
• MIM: 601416
• UniProt ID: Q92504