Recombinant Human SLC27A2 Protein (283-620 aa), His-SUMO-tagged
Cat.No. : | SLC27A2-814H |
Product Overview : | Recombinant Human SLC27A2 Protein (283-620 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Metabolism. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 283-620 aa |
Description : | Acyl-CoA synthetase probably involved in bile acid metabolism. Proposed to activate C27 precurors of bile acids to their CoA thioesters derivatives before side chain cleavage via peroxisomal beta-oxidation occurs. In vitro, activates 3-alpha,7-alpha,12-alpha-trihydroxy-5-beta-cholestanate (THCA), the C27 precursor of cholic acid deriving from the de novo synthesis from cholesterol. Does not utilize C24 bile acids as substrates. In vitro, also activates long- and branched-chain fatty acids and may have additional roles in fatty acid metabolism. May be involved in translocation of long-chain fatty acids (LFCA) across mbranes. |
Form : | Tris-based buffer, 50% glycerol |
Molecular Mass : | 54.8 kDa |
AA Sequence : | GATLALRTKFSASQFWDDCRKYNVTVIQYIGELLRYLCNSPQKPNDRDHKVRLALGNGLRGDVWRQFVKRFGDICIYEFYAATEGNIGFMNYARKVGAVGRVNYLQKKIITYDLIKYDVEKDEPVRDENGYCVRVPKGEVGLLVCKITQLTPFNGYAGAKAQTEKKKLRDVFKKGDLYFNSGDLLMVDHENFIYFHDRVGDTFRWKGENVATTEVADTVGLVDFVQEVNVYGVHVPDHEGRIGMASIKMKENHEFDGKKLFQHIADYLPSYARPRFLRIQDTIEITGTFKHRKMTLVEEGFNPAVIKDALYFLDDTAKMYVPMTEDIYNAISAKTLKL |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with concentration instruction is sent along with the products. |
Gene Name | SLC27A2 solute carrier family 27 (fatty acid transporter), member 2 [ Homo sapiens ] |
Official Symbol | SLC27A2 |
Synonyms | SLC27A2; FACVL1; ACSVL1; FATP2; hFACVL1; HsT17226; VLACS; VLCS; FATP-2; |
Gene ID | 11001 |
mRNA Refseq | NM_001159629 |
Protein Refseq | NP_001153101 |
MIM | 603247 |
UniProt ID | O14975 |
◆ Recombinant Proteins | ||
RFL20703RF | Recombinant Full Length Rat Very Long-Chain Acyl-Coa Synthetase(Slc27A2) Protein, His-Tagged | +Inquiry |
SLC27A2-8305M | Recombinant Mouse SLC27A2 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL14525MF | Recombinant Full Length Mouse Very Long-Chain Acyl-Coa Synthetase(Slc27A2) Protein, His-Tagged | +Inquiry |
SLC27A2-15348M | Recombinant Mouse SLC27A2 Protein | +Inquiry |
SLC27A2-5146R | Recombinant Rat SLC27A2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SLC27A2-1750HCL | Recombinant Human SLC27A2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SLC27A2 Products
Required fields are marked with *
My Review for All SLC27A2 Products
Required fields are marked with *
0
Inquiry Basket