Recombinant Human SLC25A20 protein, GST-tagged
Cat.No. : | SLC25A20-3498H |
Product Overview : | Recombinant Human SLC25A20 protein(O43772)(1-301aa), fused to N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Source : | E. coli |
Species : | Human |
Tag : | GST |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 59.9 kDa |
Protein length : | 1-301aa |
AA Sequence : | MADQPKPISPLKNLLAGGFGGVCLVFVGHPLDTVKVRLQTQPPSLPGQPPMYSGTFDCFRKTLFREGITGLYRGMAAPIIGVTPMFAVCFFGFGLGKKLQQKHPEDVLSYPQLFAAGMLSGVFTTGIMTPGERIKCLLQIQASSGESKYTGTLDCAKKLYQEFGIRGIYKGTVLTLMRDVPASGMYFMTYEWLKNIFTPEGKRVSELSAPRILVAGGIAGIFNWAVAIPPDVLKSRFQTAPPGKYPNGFRDVLRELIRDEGVTSLYKGFNAVMIRAFPANAACFLGFEVAMKFLNWATPNL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | SLC25A20 solute carrier family 25 (carnitine/acylcarnitine translocase), member 20 [ Homo sapiens ] |
Official Symbol | SLC25A20 |
Synonyms | SLC25A20; solute carrier family 25 (carnitine/acylcarnitine translocase), member 20; CACT; mitochondrial carnitine/acylcarnitine carrier protein; CAC; carnitine acylcarnitine carrier; carnitine/acylcarnitine translocase; |
Gene ID | 788 |
mRNA Refseq | NM_000387 |
Protein Refseq | NP_000378 |
MIM | 613698 |
UniProt ID | O43772 |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All SLC25A20 Products
Required fields are marked with *
My Review for All SLC25A20 Products
Required fields are marked with *
0
Inquiry Basket