Recombinant Human SLC25A20 protein, GST-tagged

• Cat.No.: SLC25A20-3498H
• Product Overview: Recombinant Human SLC25A20 protein(O43772)(1-301aa), fused to N-terminal GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 1-301aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 59.9 kDa
• AA Sequence: MADQPKPISPLKNLLAGGFGGVCLVFVGHPLDTVKVRLQTQPPSLPGQPPMYSGTFDCFRKTLFREGITGLYRGMAAPIIGVTPMFAVCFFGFGLGKKLQQKHPEDVLSYPQLFAAGMLSGVFTTGIMTPGERIKCLLQIQASSGESKYTGTLDCAKKLYQEFGIRGIYKGTVLTLMRDVPASGMYFMTYEWLKNIFTPEGKRVSELSAPRILVAGGIAGIFNWAVAIPPDVLKSRFQTAPPGKYPNGFRDVLRELIRDEGVTSLYKGFNAVMIRAFPANAACFLGFEVAMKFLNWATPNL
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: SLC25A20 solute carrier family 25 (carnitine/acylcarnitine translocase), member 20 [ Homo sapiens ]
• Official Symbol: SLC25A20
• Synonyms: SLC25A20; solute carrier family 25 (carnitine/acylcarnitine translocase), member 20; CACT; mitochondrial carnitine/acylcarnitine carrier protein; CAC; carnitine acylcarnitine carrier; carnitine/acylcarnitine translocase
• Gene ID: 788
• mRNA Refseq: NM_000387
• Protein Refseq: NP_000378
• MIM: 613698
• UniProt ID: O43772