Recombinant Human SLC25A1 Protein (47-87 aa), GST-tagged

• Cat.No.: SLC25A1-1209H
• Product Overview: Recombinant Human SLC25A1 Protein (47-87 aa) is produced by E. coli expression system. This protein is fused with a GST tag at the N-terminal. Research Area: Transport. Protein Description: Partial.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 47-87 aa
• Description: Involved in citrate-H+/malate exchange. Important for the bioenergetics of hepatic cells as it provides a carbon source for fatty acid and sterol biosyntheses, and NAD+ for the glycolytic pathway.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 31.8 kDa
• AA Sequence: EYVKTQLQLDERSHPPRYRGIGDCVRQTVRSHGVLGLYRGL
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products. Please refer to it for detailed information.

Gene Information

• Gene Name: SLC25A1 solute carrier family 25 member 1 [ Homo sapiens (human) ]
• Official Symbol: SLC25A1
• Synonyms: CTP; SEA; CMS23; D2L2AD; SLC20A3
• Gene ID: 6576
• mRNA Refseq: NM_005984
• Protein Refseq: NP_005975
• UniProt ID: P53007