Recombinant Human SLC22A1 protein, His-SUMO-tagged

Cat.No. : SLC22A1-8544H
Product Overview : Recombinant Human SLC22A1 protein(O15245)(43-149aa), fused with N-terminal His and SUMO tag, was expressed in E.coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&SUMO
Protein Length : 43-149aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 24.5 kDa
Purity : Greater than 85% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
AA Sequence : GFTPDHHCQSPGVAELSQRCGWSPAEELNYTVPGLGPAGEAFLGQCRRYEVDWNQSALSCVDPLASLATNRSHLPLGPCQDGWVYDTPGSSIVTEFNLVCADSWKLD
Gene Name SLC22A1 solute carrier family 22 (organic cation transporter), member 1 [ Homo sapiens ]
Official Symbol SLC22A1
Synonyms SLC22A1; solute carrier family 22 (organic cation transporter), member 1; solute carrier family 22 member 1; OCT1; organic cation transporter 1; HOCT1; oct1_cds;
Gene ID 6580
mRNA Refseq NM_003057
Protein Refseq NP_003048
MIM 602607
UniProt ID O15245

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All SLC22A1 Products

Required fields are marked with *

My Review for All SLC22A1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon