Recombinant Human SLC1A3

• Cat.No.: SLC1A3-26509TH
• Product Overview: Recombinant fragment corresponding to amino acids 162-237 of Human EAAT1 with an N terminal proprietary tag; Predicted MWt 33.99.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 76 amino acids
• Description: This gene encodes a member of a member of a high affinity glutamate transporter family. Mutations in this gene are associated with episodic ataxia, Type 6. Alternative splicing results in multiple transcript variants.
• Molecular Weight: 33.990kDa inclusive of tags
• Tissue specificity: Highly expressed in cerebellum, but also found in frontal cortex, hippocampus and basal ganglia.
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: VRVTAADAFLDLIRNMFPPNLVEACFKQFKTNYEKRSFKVPIQANETLVGAVINNVSEAMETLTRITEELVPVPGS
• Sequence Similarities: Belongs to the sodium:dicarboxylate (SDF) symporter (TC 2.A.23) family. SLC1A3 subfamily.

Gene Information

• Gene Name: SLC1A3 solute carrier family 1 (glial high affinity glutamate transporter), member 3 [ Homo sapiens ]
• Official Symbol: SLC1A3
• Synonyms: SLC1A3; solute carrier family 1 (glial high affinity glutamate transporter), member 3; excitatory amino acid transporter 1; EA6; EAAT1; GLAST; glutamate transporter variant EAAT1ex9skip
• Gene ID: 6507
• mRNA Refseq: NM_001166695
• Protein Refseq: NP_001160167
• MIM: 600111
• Uniprot ID: P43003
• Chromosome Location: 5p13
• Pathway: Astrocytic Glutamate-Glutamine Uptake And Metabolism, organism-specific biosystem; Glutamatergic synapse, organism-specific biosystem; Glutamatergic synapse, conserved biosystem; Neuronal System, organism-specific biosystem; Neurotransmitter uptake and Metabolism In Glial Cells, organism-specific biosystem
• Function: L-glutamate transmembrane transporter activity; glutamate binding; high-affinity glutamate transmembrane transporter activity; sodium:dicarboxylate symporter activity; symporter activity