Recombinant Human SLC1A3
Cat.No. : | SLC1A3-26509TH |
Product Overview : | Recombinant fragment corresponding to amino acids 162-237 of Human EAAT1 with an N terminal proprietary tag; Predicted MWt 33.99. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 76 amino acids |
Description : | This gene encodes a member of a member of a high affinity glutamate transporter family. Mutations in this gene are associated with episodic ataxia, Type 6. Alternative splicing results in multiple transcript variants. |
Molecular Weight : | 33.990kDa inclusive of tags |
Tissue specificity : | Highly expressed in cerebellum, but also found in frontal cortex, hippocampus and basal ganglia. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | VRVTAADAFLDLIRNMFPPNLVEACFKQFKTNYEKRSFKVPIQANETLVGAVINNVSEAMETLTRITEELVPVPGS |
Sequence Similarities : | Belongs to the sodium:dicarboxylate (SDF) symporter (TC 2.A.23) family. SLC1A3 subfamily. |
Gene Name | SLC1A3 solute carrier family 1 (glial high affinity glutamate transporter), member 3 [ Homo sapiens ] |
Official Symbol | SLC1A3 |
Synonyms | SLC1A3; solute carrier family 1 (glial high affinity glutamate transporter), member 3; excitatory amino acid transporter 1; EA6; EAAT1; GLAST; glutamate transporter variant EAAT1ex9skip; |
Gene ID | 6507 |
mRNA Refseq | NM_001166695 |
Protein Refseq | NP_001160167 |
MIM | 600111 |
Uniprot ID | P43003 |
Chromosome Location | 5p13 |
Pathway | Astrocytic Glutamate-Glutamine Uptake And Metabolism, organism-specific biosystem; Glutamatergic synapse, organism-specific biosystem; Glutamatergic synapse, conserved biosystem; Neuronal System, organism-specific biosystem; Neurotransmitter uptake and Metabolism In Glial Cells, organism-specific biosystem; |
Function | L-glutamate transmembrane transporter activity; glutamate binding; high-affinity glutamate transmembrane transporter activity; sodium:dicarboxylate symporter activity; symporter activity; |
◆ Recombinant Proteins | ||
SLC1A3-8250M | Recombinant Mouse SLC1A3 Protein, His (Fc)-Avi-tagged | +Inquiry |
SLC1A3-1377H | Recombinant Human SLC1A3 protein(146-236aa), His-tagged | +Inquiry |
SLC1A3-1376H | Recombinant Human SLC1A3 protein, His-KSI-tagged | +Inquiry |
SLC1A3-298H | Recombinant Human SLC1A3 Protein (1-542), N-GST-tagged | +Inquiry |
SLC1A3-4047R | Recombinant Rhesus Macaque SLC1A3 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SLC1A3-1619HCL | Recombinant Human SLC1A3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SLC1A3 Products
Required fields are marked with *
My Review for All SLC1A3 Products
Required fields are marked with *
0
Inquiry Basket