Recombinant Human SLAMF6 Protein, C-His-tagged
Cat.No. : | SLAMF6-016H |
Product Overview : | Recombinant Human SLAMF6 Protein with C-His tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Description : | SLAMF6 (CD352/NTB-A) is a type-I transmembrane glycoprotein belonging to the signaling lymphocytic activation molecule (SLAM) family of immunomodulatory receptors. Like other members of the SLAM receptor family, SLAMF6 contains Ig-like domains within its extracellular region and conserved tyrosine-based signaling motifs within its intracellular domain that, when phosphorylated, bind to the SAP and EAT-2 signaling adaptors. SLAMF6 is expressed on the surface of multiple types of immune cells, such as those of the B, T, and NK lineages. Its activation is triggered by homotypic interactions involving its extracellular domain. Indeed, research studies have shown that in T-cells, SLAMF6 engagement facilitates activation and cytokine production. Similarly, homotypic ligand-mediated engagement of SLAMF6 on NK cells activates signaling cascades that drive proliferation, cytotoxicity, and cytokine production. |
Molecular Mass : | ~23 kDa |
AA Sequence : | QSSLTPLMVNGILGESVTLPLEFPAGEKVNFITWLFNETSLAFIVPHETKSPEIHVTNPKQGKRLNFTQSYSLQLSNLKMEDTGSYRAQISTKTSAKLSSYTLRILRQLRNIQVTNHSQLFQNMTCELHLTCSVEDADDNVSFRWEALGNTLSSQPNLTVSWDPRISSEQDYTCIAENAVSNLSFSVSAQKLCEDVKIQYTDTKM |
Purity : | Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE). |
Notes : | For research use only, not for use in diagnostic procedure. |
Storage : | Store at 4 centigrade short term. Aliquot and store at -20 centigrade long term. Avoid freeze-thaw cycles. |
Concentration : | ≥0.5 mg/mL |
Storage Buffer : | PBS, 4M Urea, pH7.4 |
Gene Name | SLAMF6 SLAM family member 6 [ Homo sapiens (human) ] |
Official Symbol | SLAMF6 |
Synonyms | SLAMF6; SLAM family member 6; CD352; KALI; KALIb; Ly108; NTB A; NTBA; SF2000; NTBA receptor; NK-T-B-antigen; activating NK receptor; natural killer-, T- and B-cell antigen; NTB-A; FLJ50657; MGC104953; |
Gene ID | 114836 |
mRNA Refseq | NM_001184714 |
Protein Refseq | NP_001171643 |
MIM | 606446 |
UniProt ID | Q96DU3 |
◆ Recombinant Proteins | ||
SLAMF6-3989H | Recombinant Human SLAMF6 Protein (Met1-Met226), C-His tagged | +Inquiry |
SLAMF6-235H | Recombinant Human SLAMF6, LEVLFQ tagged | +Inquiry |
SLAMF6-1773R | Recombinant Rhesus Monkey SLAMF6 Protein | +Inquiry |
Slamf6-4020M | Active Recombinant Mouse SLAMF6 protein, His-tagged | +Inquiry |
SLAMF6-1953H | Recombinant Human SLAMF6 protein, hFc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SLAMF6-2108MCL | Recombinant Mouse SLAMF6 cell lysate | +Inquiry |
SLAMF6-913HCL | Recombinant Human SLAMF6 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SLAMF6 Products
Required fields are marked with *
My Review for All SLAMF6 Products
Required fields are marked with *
0
Inquiry Basket