Recombinant Human SKP1 protein, C-terminal GST-tagged-tagged
Cat.No. : | SKP1-3496H |
Product Overview : | Recombinant Human SKP1 protein(P63208)(2-163aa), fused to C-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 2-163aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 45.5 kDa |
AA Sequence : | PSIKLQSSDGEIFEVDVEIAKQSVTIKTMLEDLGMDDEGDDDPVPLPNVNAAILKKVIQWCTHHKDDPPPPEDDENKEKRTDDIPVWDQEFLKVDQGTLFELILAANYLDIKGLLDVTCKTVANMIKGKTPEEIRKTFNIKNDFTEEEEAQVRKENQWCEEK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | SKP1 S-phase kinase-associated protein 1 [ Homo sapiens ] |
Official Symbol | SKP1 |
Synonyms | SKP1; S-phase kinase-associated protein 1; S phase kinase associated protein 1A (p19A) , SKP1A; EMC19; MGC34403; OCP II; OCP2; p19A; TCEB1L; SIII; OCP-2; p19skp1; organ of Corti protein 2; organ of Corti protein II; cyclin A/CDK2-associated p19; transcription elongation factor B; cyclin A/CDK2-associated protein p19; cyclin-A/CDK2-associated protein p19; RNA polymerase II elongation factor-like protein OCP2; SKP1A; OCP-II; |
Gene ID | 6500 |
mRNA Refseq | NM_006930 |
Protein Refseq | NP_008861 |
MIM | 601434 |
UniProt ID | P63208 |
◆ Recombinant Proteins | ||
SKP1-31409TH | Recombinant Human SKP1 | +Inquiry |
SKP1-661C | Recombinant Cynomolgus Monkey SKP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
SKP1-011H | Recombinant Human SKP1 Protein, His-tagged | +Inquiry |
SKP1-1822H | Recombinant Human S-phase Kinase-associated Protein 1 | +Inquiry |
SKP1-4215R | Recombinant Rhesus monkey SKP1 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SKP1-1813HCL | Recombinant Human SKP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SKP1 Products
Required fields are marked with *
My Review for All SKP1 Products
Required fields are marked with *
0
Inquiry Basket