Recombinant Human SKP1 protein, C-terminal GST-tagged-tagged

Source :	E. coli
Species :	Human
Tag :	GST
Form :	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass :	45.5 kDa
Protein length :	2-163aa
AA Sequence :	PSIKLQSSDGEIFEVDVEIAKQSVTIKTMLEDLGMDDEGDDDPVPLPNVNAAILKKVIQWCTHHKDDPPPPEDDENKEKRTDDIPVWDQEFLKVDQGTLFELILAANYLDIKGLLDVTCKTVANMIKGKTPEEIRKTFNIKNDFTEEEEAQVRKENQWCEEK
Purity :	Greater than 90% as determined by SDS-PAGE.
Storage :	Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution :	Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Name	SKP1 S-phase kinase-associated protein 1 [ Homo sapiens ]
Official Symbol	SKP1
Synonyms	SKP1; S-phase kinase-associated protein 1; S phase kinase associated protein 1A (p19A) , SKP1A; EMC19; MGC34403; OCP II; OCP2; p19A; TCEB1L; SIII; OCP-2; p19skp1; organ of Corti protein 2; organ of Corti protein II; cyclin A/CDK2-associated p19; transcription elongation factor B; cyclin A/CDK2-associated protein p19; cyclin-A/CDK2-associated protein p19; RNA polymerase II elongation factor-like protein OCP2; SKP1A; OCP-II;
Gene ID	6500
mRNA Refseq	NM_006930
Protein Refseq	NP_008861
MIM	601434
UniProt ID	P63208