Recombinant Human SIRT2 protein, T7/His-tagged

Cat.No. : SIRT2-174H
Product Overview : Recombinant human SIRT2 cDNA (389aa, isoform-2) protein fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&T7
Protein Length : 389 a.a.
Form : 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
AA Sequence : MASMTGGQQMGRGHHHHHHGNLYFQGGEFDFLRNLFSQTLSLGSQKERLLDELTLEGVARYMQSERCRRVICLVG AGISTSAGIPDFRSPSTGLYDNLEKYHLPYPEAIFEISYFKKHPEPFFALAKELYPGQFKPTICHYFMRLLKDKG LLLRCYTQNIDTLERIAGLEQEDLVEAHGTFYTSHCVSASCRHEYPLSWMKEKIFSEVTPKCEDCQSLVKPDIVF FGESLPARFFSCMQSDFLKVDLLLVMGTSLQVQPFASLISKAPLSTPRLLINKEKAGQSDPFLGMIMGLGGGMDF DSKKAYRDVAWLGECDQGCLALAELLGWKKELEDLVRREHASIDAQSGAGVPNPSTSASPKKSPPPAKDEARTTE REKPQ
Purity : >90% by SDS-PAGE.
Storage : Keep at -80°C for long term storage. Product is stable at 4 °C for at least 30 days.
Gene Name SIRT2 sirtuin 2 [ Homo sapiens ]
Official Symbol SIRT2
Synonyms SIRT2; sirtuin 2; NAD-dependent deacetylase sirtuin-2; sirtuin type 2; SIR2-like protein 2; SIR2; SIR2L; SIR2L2; FLJ35621; FLJ37491;
Gene ID 22933
mRNA Refseq NM_030593
Protein Refseq NP_085096
MIM 604480
UniProt ID Q8IXJ6
Chromosome Location 19q13
Pathway Signaling events mediated by HDAC Class I, organism-specific biosystem; Signaling events mediated by HDAC Class III, organism-specific biosystem;
Function NOT NAD+ ADP-ribosyltransferase activity; NAD+ binding; NAD-dependent histone deacetylase activity; histone acetyltransferase binding; histone deacetylase binding; hydrolase activity; metal ion binding; protein binding; protein deacetylase activity; transcription factor binding; tubulin deacetylase activity; ubiquitin binding; zinc ion binding;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All SIRT2 Products

Required fields are marked with *

My Review for All SIRT2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon