Recombinant Human SH3GL1 protein, GST-tagged

Cat.No. : SH3GL1-301164H
Product Overview : Recombinant Human SH3GL1 (233-313 aa) protein, fused to GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Source : E. coli
Species : Human
Tag : GST
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
Protein length : Leu233-Ala313
AA Sequence : LDELAEKLKRRMREASSRPKREYKPKPREPFDLGEPEQSNGGFPCTTAPKIAASSSFRSSDKPIRTPSRSMPPLDQPSCKA
Purity : 98%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Stability : Store for up to 12 months at -20°C to -80°C as lyophilized powder.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Gene Name SH3GL1 SH3-domain GRB2-like 1 [ Homo sapiens ]
Official Symbol SH3GL1
Synonyms SH3GL1; SH3-domain GRB2-like 1; endophilin-A2; CNSA1; EEN; extra 11 19 leukemia fusion; fusion partner of MLL; MGC111371; SH3 domain GRB2 like 1; SH3 containing Grb 2 like 1 protein; SH3 containing protein EEN; SH3D2B; SH3P8; endophilin-2; SH3 domain protein 2B; EEN fusion partner of MLL; extra 11-19 leukemia fusion; SH3-containing Grb-2-like 1 protein; SH3 domain-containing GRB2-like protein 1; extra eleven-nineteen leukemia fusion gene protein;
Gene ID 6455
mRNA Refseq NM_001199943
Protein Refseq NP_001186872
MIM 601768
UniProt ID Q99961

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All SH3GL1 Products

Required fields are marked with *

My Review for All SH3GL1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon