Recombinant Human SFXN3 protein, His-tagged
Cat.No. : | SFXN3-2627H |
Product Overview : | Recombinant Human SFXN3 protein(1-144 aa), fused with N-terminal His tag, was expressed in E. coli. |
Availability | March 09, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-144 aa |
Tag : | N-His |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
AA Sequence : | MESKMGELPLDINIQEPRWDQSTFLGRARHFFTVTDPRNLLLSGAQLEASRNIVQNYRAGVVTPGITEDQLWRAKYVYDSAFHPDTGEKVVLIGRMSAQVPMNMTITGCMLTFYRKTPTVVFWQWVNQSFNAIVNYSNRSGDTP |
Gene Name | SFXN3 sideroflexin 3 [ Homo sapiens ] |
Official Symbol | SFXN3 |
Synonyms | SFXN3; sideroflexin 3; sideroflexin-3; SFX3; BA108L7.2; |
Gene ID | 81855 |
mRNA Refseq | NM_030971 |
Protein Refseq | NP_112233 |
UniProt ID | Q9BWM7 |
◆ Cell & Tissue Lysates | ||
ABCG8-9141HCL | Recombinant Human ABCG8 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ABCG8 Products
Required fields are marked with *
My Review for All ABCG8 Products
Required fields are marked with *
0
Inquiry Basket