Recombinant Human SFTPD Protein (21–375 aa), His-tagged
Cat.No. : | SFTPD-1849H |
Product Overview : | Recombinant Human SFTPD Protein (21–375 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Cancer. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Yeast |
Tag : | His |
Protein Length : | 21–375 aa |
Description : | Contributes to the lung's defense against inhaled microorganisms, organic antigens and toxins. Interacts with compounds such as bacterial lipopolysaccharides, oligosaccharides and fatty acids and modulates leukocyte action in immune response. May participate in the Extracellular domain reorganization or turnover of pulmonary surfactant. Binds strongly maltose residues and to a lesser extent other alpha-glucosyl moieties. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 35.2 kDa |
AA Sequence : | AEMKTYSHRTMPSACTLVMCSSVESGLPGRDGRDGREGPRGEKGDPGLPGAAGQAGMPGQAGPVGPKGDNGSVGEPGPKGDTGPSGPPGPPGVPGPAGREGPLGKQGNIGPQGKPGPKGEAGPKGEVGAPGMQGSAGARGLAGPKGERGVPGERGVPGNTGAAGSAGAMGPQGSPGARGPPGLKGDKGIPGDKGAKGESGLPDVASLRQQVEALQGQVQHLQAAFSQYKKVELFPNGQSVGEKIFKTAGFVKPFTEAQLLCTQAGGQLASPRSAAENAALQQLVVAKNEAAFLSMTDSKTEGKFTYPTGESLVYSNWAPGEPNDDGGSEDCVEIF |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Gene Name | SFTPD surfactant protein D [ Homo sapiens ] |
Official Symbol | SFTPD |
Synonyms | SFTPD; surfactant protein D; COLEC7; SP D; collectin 7; collectin-7; SP-D; PSP-D; SFTP4; |
Gene ID | 6441 |
mRNA Refseq | NM_003019 |
Protein Refseq | NP_003010 |
MIM | 178635 |
UniProt ID | P35247 |
◆ Recombinant Proteins | ||
SFTPD-5019R | Recombinant Rat SFTPD Protein, His (Fc)-Avi-tagged | +Inquiry |
Sftpd-16P | Recombinant Porcine Sftpd | +Inquiry |
Sftpd-865M | Recombinant Mouse Sftpd protein, His-tagged | +Inquiry |
SFTPD-4178R | Recombinant Rhesus SFTPD protein, His-tagged | +Inquiry |
SFTPD-6272H | Recombinant Human SFTPD Protein (Met23-Phe375), N-His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SFTPD-2144HCL | Recombinant Human SFTPD cell lysate | +Inquiry |
SFTPD-2675MCL | Recombinant Mouse SFTPD cell lysate | +Inquiry |
SFTPD-2250CCL | Recombinant Cynomolgus SFTPD cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SFTPD Products
Required fields are marked with *
My Review for All SFTPD Products
Required fields are marked with *
0
Inquiry Basket