Recombinant Human SFTPA2, His-tagged

• Cat.No.: SFTPA2-188H
• Product Overview: Recombinant Human Pulmonary Surfactant-Associated Protein A2/SFTPA2 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Glu21-Phe248) of Human SFTPA2 fused with a polyhistidine tag at the C-terminus.

Specification

• Description: Pulmonary Surfactant-Associated Protein A2 (SFTPA2) is a member of the SFTPA family. SFTPA2 is a secreted protein and contains one C-type lectin domain and one collagen-like domain. In the presence of calcium ions, it binds to surfactant phospholipids and contributes to lowering the surface tension at the air-liquid interface in the alveoli of the mammalian lung and is essential for normal respiration. Defects in SFTPA2 are a cause of pulmonary fibrosis idiopathic, and results in acute lung injury with subsequent scarring and endstage lung disease.
• Source: HEK293
• Species: Human
• Tag: His
• AA Sequence: EVKDVCVGSPGIPGTPGSHGLPGRDGRDGVKGDPGPPGPMGPPGETPCPPGNNGLPGAPGVPGER GEKGEAGERGPPGLPAHLDEELQATLHDFRHQILQTRGALSLQGSIMTVGEKVFSSNGQSITFDA IQEACARAGGRIAVPRNPEENEAIASFVKKYNTYAYVGLTEGPSPGDFRYSDGTPVNYTNWYRGE PAGRGKEQCVEMYTDGQWNDRNCLYSRLTICEFVDHHHHHH
• Endotoxin: Less than 0.1 ng/μg (1 IEU/μg).
• Purity: Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.