Recombinant Human SERPINE2, GST-tagged

• Cat.No.: SERPINE2-2602H
• Product Overview: Recombinant Human SERPINE2(1 a.a. - 398 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a member of the serpin family of proteins, a group of proteins that inhibit serine proteases. Thrombin, urokinase, plasmin and trypsin are among the proteases that this family member can inhibit. This gene is a susceptibility gene for chronic obstructive pulmonary disease and for emphysema. Alternative splicing results in multiple transcript variants.
• Molecular Mass: 70.4 kDa
• AA Sequence: MNWHLPLFLLASVTLPSICSHFNPLSLEELGSNTGIQVFNQIVKSRPHDNIVISPHGIASVLGMLQLGADGRTKK QLAMVMRYGVNGVGKILKKINKAIVSKKNKDIVTVANAVFVKNASEIEVPFVTRNKDVFQCEVRNVNFEDPASAC DSINAWVKNETRDMIDNLLSPDLIDGVLTRLVLVNAVYFKGLWKSRFQPENTKKRTFVAADGKSYQVPMLAQLSV FRCGSTSAPNDLWYNFIELPYHGESISMLIALPTESSTPLSAIIPHISTKTIDSWMSIMVPKRVQVILPKFTAVA QTDLKEPLKVLGITDMFDSSKANFAKITTGSENLHVSHILQKAKIEVSEDGTKASAATTAILIARSSPPWFIVDR PFLFFIRHNPTGAVLFMGQINKP
• Applications: ELISA; WB-Re; AP; Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: SERPINE2 serpin peptidase inhibitor, clade E (nexin, plasminogen activator inhibitor type 1), member 2 [ Homo sapiens (human) ]
• Official Symbol: SERPINE2
• Synonyms: SERPINE2; GDN; PI7; PN1; PNI; PI-7; PN-1; GDNPF; serpin peptidase inhibitor, clade E (nexin, plasminogen activator inhibitor type 1), member 2; glia-derived nexin; serpin E2; protease nexin I; peptidase inhibitor 7; glial-derived neurite promoting factor
• Gene ID: 5270
• mRNA Refseq: NM_006216
• Protein Refseq: NP_006207
• MIM: 177010
• UniProt ID: P07093
• Chromosome Location: 2q36.1
• Pathway: Dissolution of Fibrin Clot; Hemostasis
• Function: glycosaminoglycan binding; heparin binding; serine-type endopeptidase inhibitor activity