Recombinant Human SERPINB4 protein(131-210 aa), C-His-tagged

• Cat.No.: SERPINB4-2774H
• Product Overview: Recombinant Human SERPINB4 protein(P48594)(131-210 aa), fused with C-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 131-210 aa
• Form: 0.15 M Phosphate buffered saline
• Storage: Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
  Up to 12 months when aliquoted and stored at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
• AA Sequence: VESTDFANAPEESRKKINSWVESQTNEKIKNLFPDGTIGNDTTLVLVNAIYFKGQWENKFKKENTKEEKFWPNKNTYKSV

Gene Information

• Gene Name: SERPINB4 serpin peptidase inhibitor, clade B (ovalbumin), member 4 [ Homo sapiens ]
• Official Symbol: SERPINB4
• Synonyms: SERPINB4; serpin peptidase inhibitor, clade B (ovalbumin), member 4; SCCA2, serine (or cysteine) proteinase inhibitor, clade B (ovalbumin), member 4; serpin B4; LEUPIN; PI11; SCCA 2; SCCA1; squamous cell carcinoma antigen 2; PI-11; peptidase inhibitor 11; SCCA2/SCCA1 fusion protein; squamous cell carcinoma antigen 1; protease inhibitor (leucine-serpin); serine (or cysteine) proteinase inhibitor, clade B (ovalbumin), member 4; SCCA2; SCCA-2
• Gene ID: 6318
• mRNA Refseq: NM_002974
• Protein Refseq: NP_002965
• MIM: 600518
• UniProt ID: P48594