Recombinant Human SENP2 protein

• Cat.No.: SENP2-32H
• Product Overview: Recombinant Human SENP2(Asp363-Leu589) was expressed in E. coli.

Specification

• Description: SENP2 is an enzyme that belongs to the peptidase C48 family. SENP2 is a protease that catalyzes two essential functions in the SUMO pathway: processing of full-length SUMO1, SUMO2 and SUMO3 to their mature forms and deconjugation of SUMO1, SUMO2 and SUMO3 from targeted proteins. SUMO1 is a small ubiquitin-like protein that can be covalently conjugated to other proteins. It has been implicated as a down-regulator of CTNNB1 levels and may therefore be a modulator of the Wnt pathway.
• Source: E. coli
• Species: Human
• Form: Supplied as a 0.2 μm filtered solution of 50mM HEPES,5% Glycerol, pH 7.4.
• AA Sequence: DDLLELTEDMEKEISNALGHGPQDEILSSAFKLRITRGDIQTLKNYHWLNDEVINFYMNLLVERN KKQGYPALHVFSTFFYPKLKSGGYQAVKRWTKGVNLFEQEIILVPIHRKVHWSLVVIDLRKKCLK YLDSMGQKGHRICEILLQYLQDESKTKRNSDLNLLEWTHHSMKPHEIPQQLNGSDCGMFTCKYAD YISRDKPITFTQHQMPLFRKKMVWEILHQQLL
• Endotoxin: Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
• Purity: Greater than 95% as determined by reducing SDS-PAGE.
• Storage: Store at < -20 centigrade, stable for 6 months after receipt.
  Please minimize freeze-thaw cycles.
• Tag: Non
• Protein length: 363-589 a.a.

Gene Information

• Gene Name: SENP2 SUMO1/sentrin/SMT3 specific peptidase 2 [ Homo sapiens ]
• Official Symbol: SENP2
• Synonyms: SENP2; SUMO1/sentrin/SMT3 specific peptidase 2; SUMO1/sentrin/SMT3 specific protease 2; sentrin-specific protease 2; AXAM2; DKFZp762A2316; KIAA1331; SMT3IP2; SMT3-specific isopeptidase 2; sentrin/SUMO-specific protease SENP2
• Gene ID: 59343
• mRNA Refseq: NM_021627
• Protein Refseq: NP_067640
• MIM: 608261
• UniProt ID: Q9HC62
• Chromosome Location: 3q28
• Pathway: Nuclear pore complex, organism-specific biosystem; RNA transport, organism-specific biosystem; RNA transport, conserved biosystem; Wnt Signaling Pathway NetPath, organism-specific biosystem; Wnt signaling pathway, organism-specific biosystem; Wnt signaling pathway, conserved biosystem
• Function: SUMO-specific protease activity; cysteine-type peptidase activity; peptidase activity; protein binding; protein domain specific binding