Recombinant Human SENP2 protein

Cat.No. : SENP2-32H
Product Overview : Recombinant Human SENP2(Asp363-Leu589) was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : Non
Protein Length : 363-589 a.a.
Description : SENP2 is an enzyme that belongs to the peptidase C48 family. SENP2 is a protease that catalyzes two essential functions in the SUMO pathway: processing of full-length SUMO1, SUMO2 and SUMO3 to their mature forms and deconjugation of SUMO1, SUMO2 and SUMO3 from targeted proteins. SUMO1 is a small ubiquitin-like protein that can be covalently conjugated to other proteins. It has been implicated as a down-regulator of CTNNB1 levels and may therefore be a modulator of the Wnt pathway.
Form : Supplied as a 0.2 μm filtered solution of 50mM HEPES,5% Glycerol, pH 7.4.
AA Sequence : DDLLELTEDMEKEISNALGHGPQDEILSSAFKLRITRGDIQTLKNYHWLNDEVINFYMNLLVERN KKQGYPALHVFSTFFYPKLKSGGYQAVKRWTKGVNLFEQEIILVPIHRKVHWSLVVIDLRKKCLK YLDSMGQKGHRICEILLQYLQDESKTKRNSDLNLLEWTHHSMKPHEIPQQLNGSDCGMFTCKYAD YISRDKPITFTQHQMPLFRKKMVWEILHQQLL
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Purity : Greater than 95% as determined by reducing SDS-PAGE.
Storage : Store at < -20 centigrade, stable for 6 months after receipt.
Please minimize freeze-thaw cycles.
Gene Name SENP2 SUMO1/sentrin/SMT3 specific peptidase 2 [ Homo sapiens ]
Official Symbol SENP2
Synonyms SENP2; SUMO1/sentrin/SMT3 specific peptidase 2; SUMO1/sentrin/SMT3 specific protease 2; sentrin-specific protease 2; AXAM2; DKFZp762A2316; KIAA1331; SMT3IP2; SMT3-specific isopeptidase 2; sentrin/SUMO-specific protease SENP2;
Gene ID 59343
mRNA Refseq NM_021627
Protein Refseq NP_067640
MIM 608261
UniProt ID Q9HC62
Chromosome Location 3q28
Pathway Nuclear pore complex, organism-specific biosystem; RNA transport, organism-specific biosystem; RNA transport, conserved biosystem; Wnt Signaling Pathway NetPath, organism-specific biosystem; Wnt signaling pathway, organism-specific biosystem; Wnt signaling pathway, conserved biosystem;
Function SUMO-specific protease activity; cysteine-type peptidase activity; peptidase activity; protein binding; protein domain specific binding;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All SENP2 Products

Required fields are marked with *

My Review for All SENP2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon