Recombinant Human SECTM1

Cat.No. : SECTM1-31348TH
Product Overview : Recombinant full length protein Human SECTM1 containing an N-terminal proprietary tag; Predicted MW 50.31 kDa
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 220 amino acids
Description : This gene encodes a transmembrane and secreted protein with characteristics of a type 1a transmembrane protein. It is found in a perinuclear Golgi-like pattern and thought to be involved in hematopoietic and/or immune system processes.
Molecular Weight : 50.310kDa inclusive of tags
Tissue specificity : Detected at the highest levels in peripheral blood leukocytes and breast cancer cell lines. Found in leukocytes of the myeloid lineage, with the strongest expression observed in granulocytes and no detectable expression in lymphocytes. Expressed in thymic
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : QNEGWDSPICTEGVVSVSWGENTVMSCNISNAFSHVNIKL RAHGQESAIFNEVAPGYFSRDGWQLQVQGGVAQLVIKGAR DSHAGLYMWHLVGHQRNNRQVTLEVSGAEPQSAPDTGFWP VPAVVTAVFILLVALVMFAWYRCRCSQQRREKKFFLLEPQ MKFAALRAGAQQGLSRASAELWTPDSEPTPRPLALVFKPS PLGALELLSPQPLFPYAADP
Sequence Similarities : Belongs to the SECTM family.
Gene Name SECTM1 secreted and transmembrane 1 [ Homo sapiens ]
Official Symbol SECTM1
Synonyms SECTM1; secreted and transmembrane 1; secreted and transmembrane protein 1; K12; K12 protein; type 1a transmembrane protein;
Gene ID 6398
mRNA Refseq NM_003004
Protein Refseq NP_002995
MIM 602602
Uniprot ID Q8WVN6
Chromosome Location 17q25
Function cytokine activity; signal transducer activity;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All SECTM1 Products

Required fields are marked with *

My Review for All SECTM1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon