Recombinant Human SDHAF3 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | SDHAF3-4471H |
Product Overview : | ACN9 MS Standard C13 and N15-labeled recombinant protein (NP_064571) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Description : | SDHAF3 (Succinate Dehydrogenase Complex Assembly Factor 3) is a Protein Coding gene. Diseases associated with SDHAF3 include Mitochondrial Complex Ii Deficiency and Alcohol Dependence. |
Molecular Mass : | 14.7 kDa |
AA Sequence : | MPGRHVSRVRALYKRVLQLHRVLPPDLKSLGDQYVKDEFRRHKTVGSDEAQRFLQEWEVYATALLQQANENRQNSTGKACFGTFLPEEKLNDFRDEQIGQLQELMQEATKPNRQFSISESMKPKFTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | SDHAF3 succinate dehydrogenase complex assembly factor 3 [ Homo sapiens (human) ] |
Official Symbol | SDHAF3 |
Synonyms | SDHAF3; succinate dehydrogenase complex assembly factor 3; ACN9; DC11; Sdh7; LYRM10; succinate dehydrogenase assembly factor 3, mitochondrial; ACN9 homolog; SDH assembly factor 3; protein ACN9 homolog, mitochondrial |
Gene ID | 57001 |
mRNA Refseq | NM_020186 |
Protein Refseq | NP_064571 |
MIM | 615773 |
UniProt ID | Q9NRP4 |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SDHAF3 Products
Required fields are marked with *
My Review for All SDHAF3 Products
Required fields are marked with *
0
Inquiry Basket