Recombinant Human SDHAF3 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: SDHAF3-4471H
• Product Overview: ACN9 MS Standard C13 and N15-labeled recombinant protein (NP_064571) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: SDHAF3 (Succinate Dehydrogenase Complex Assembly Factor 3) is a Protein Coding gene. Diseases associated with SDHAF3 include Mitochondrial Complex Ii Deficiency and Alcohol Dependence.
• Molecular Mass: 14.7 kDa
• AA Sequence: MPGRHVSRVRALYKRVLQLHRVLPPDLKSLGDQYVKDEFRRHKTVGSDEAQRFLQEWEVYATALLQQANENRQNSTGKACFGTFLPEEKLNDFRDEQIGQLQELMQEATKPNRQFSISESMKPKFTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: SDHAF3 succinate dehydrogenase complex assembly factor 3 [ Homo sapiens (human) ]
• Official Symbol: SDHAF3
• Synonyms: SDHAF3; succinate dehydrogenase complex assembly factor 3; ACN9; DC11; Sdh7; LYRM10; succinate dehydrogenase assembly factor 3, mitochondrial; ACN9 homolog; SDH assembly factor 3; protein ACN9 homolog, mitochondrial
• Gene ID: 57001
• mRNA Refseq: NM_020186
• Protein Refseq: NP_064571
• MIM: 615773
• UniProt ID: Q9NRP4