Recombinant Human SDCBP2 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: SDCBP2-1081H
• Product Overview: SDCBP2 MS Standard C13 and N15-labeled recombinant protein (NP_056500) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: The protein encoded by this gene contains two class II PDZ domains. PDZ domains facilitate protein-protein interactions by binding to the cytoplasmic C-terminus of transmembrane proteins, and PDZ-containing proteins mediate cell signaling and the organization of protein complexes. The encoded protein binds to phosphatidylinositol 4, 5-bisphosphate (PIP2) and plays a role in nuclear PIP2 organization and cell division. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. Read-through transcription also exists between this gene and the upstream FKBP1A (FK506 binding protein 1A, 12kDa) gene, as represented in GeneID:100528031.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 22.5 kDa
• AA Sequence: MVAPVTGYSLGVRRAEIKPGVREIHLCKDERGKTGLRLRKVDQGLFVQLVQANTPASLVGLRFGDQLLQIDGRDCAGWSSHKAHQVVKKASGDKIVVVVRDRPFQRTVTMHKDSMGHVGFVIKKGKIVSLVKGSSAARNGLLTNHYVCEVDGQNVIGLKDKKIMEILATAGNVVTLTIIPSVIYEHMVKKLPPVLLHHTMDHSIPDATRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: SDCBP2 syndecan binding protein 2 [ Homo sapiens (human) ]
• Official Symbol: SDCBP2
• Synonyms: SDCBP2; syndecan binding protein (syntenin) 2; syntenin-2; SITAC18; ST 2; ST-2; SITAC; FLJ12256
• Gene ID: 27111
• mRNA Refseq: NM_015685
• Protein Refseq: NP_056500
• MIM: 617358
• UniProt ID: Q9H190