Recombinant Human SDC4 protein
Cat.No. : | SDC4-18H |
Product Overview : | Recombinant Human SDC4 protein was expressed in Escherichia coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Non |
Protein Length : | 127 |
Description : | Syndecan-4 (SYND4) encoded by the SDC-4 gene in humans, has a molecular weight of ~20 kDa. It is one of the four vertebrate syndecans which belong to the syndecan family of Type 1 transmembrane proteins and capable of carrying heparin sulfate (HS) and chondroitin sulfate glycosaminoglycans. Syndecans are the best-characterized plasma membrane proteoglycans with two conserved cytoplasmic domains and divergent extracellular portions, except for HS attachment sites. SYND4 is the most similar to SYND2, but is more universally expressed and is found in virtually every cell type. Expression can be upregulated by TGFβ2 and in response to mechanical stress in smooth muscle, wound healing, arterial injury or acute myocardial infarction, probably in response to at least one inflammatory mediator. SYND4 has more widespread distribution than other syndecans and it is the only syndecan that has been found consistently in focal adhesions. Human SYND4 ECD shares approximately 79%, 78% and 81% a.a. identity with mouse, rat and porcine SYND4 ECD, respectively. |
Form : | Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.4. |
Bio-activity : | Fully biologically active when compared to standard. The specific activity is determined by binding ability in a functional ELISA. Immobilized rHuSYND4 at 500 ng/ml (100 μl/well) can bind rHubFGF with a linear range of 0.1-10 ng/ml. |
Molecular Mass : | Approximately 13.9 kDa, a single non-glycosylated polypeptide chain containing 127 amino acids. But it migrates with an apparent molecular mass of 22 kDa in SDS-PAGE. |
AA Sequence : | ESIRETEVIDPQDLLEGRYFSGALPDDEDVVGPGQESDDFELSGSGDLDDLEDSMIGPEVVHPLVPLDNHIPERAGSGSQVPTEPKKLEENEVIPKRISPVEESEDVSNKVSMSSTVQGSNIFERTE |
Endotoxin : | Less than 0.1 EU/μg of rHuSYND4 as determined by LAL method. |
Purity : | >95% by SDS-PAGE and HPLC analysis. |
Storage : | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
Gene Name | SDC4 |
Official Symbol | SDC4 |
Synonyms | SDC4; syndecan 4; syndecan 4 (amphiglycan, ryudocan); syndecan-4; amphiglycan; ryudocan; SYND4; syndecan proteoglycan 4; ryudocan amphiglycan; ryudocan core protein; MGC22217; |
Gene ID | 6385 |
mRNA Refseq | NM_002999 |
Protein Refseq | NP_002990 |
MIM | 600017 |
UniProt ID | P31431 |
◆ Recombinant Proteins | ||
SDC4-4107R | Recombinant Rhesus monkey SDC4 Protein, His-tagged | +Inquiry |
SDC4-411H | Recombinant Human SDC4 Protein (Met1-Glu145), His-tagged | +Inquiry |
SDC4-3947H | Recombinant Human SDC4 protein, His-SUMO-tagged | +Inquiry |
SDC4-4631H | Recombinant Syndecan 4 | +Inquiry |
SDC4-387M | Recombinant Mouse Sdc4, Fc tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SDC4-1057MCL | Recombinant Mouse SDC4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SDC4 Products
Required fields are marked with *
My Review for All SDC4 Products
Required fields are marked with *
0
Inquiry Basket