Recombinant Human SCUBE3 protein, His&Myc-tagged

• Cat.No.: SCUBE3-3244H
• Product Overview: Recombinant Human SCUBE3 protein(Q8IX30)(804-916aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli.

Specification

• Source: E.coli
• Species: Human
• Tag: His&Myc
• Protein length: 804-916a.a.
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 20.2 kDa
• AASequence: CGGELGEFTGYIESPNYPGNYPAGVECIWNINPPPKRKILIVVPEIFLPSEDECGDVLVMRKNSSPSSITTYETCQTYERPIAFTARSRKLWINFKTSEANSARGFQIPYVTY
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.

Gene Information

• Gene Name: SCUBE3 signal peptide, CUB domain, EGF-like 3 [ Homo sapiens ]
• Official Symbol: SCUBE3
• Synonyms: SCUBE3; signal peptide, CUB domain, EGF-like 3; CEGF3, CUB domain and EGF like repeat containing 3; signal peptide, CUB and EGF-like domain-containing protein 3; FLJ34743; CUB and EGF containing protein 3; CUB domain and EGF-like repeat containing 3; signal peptide, CUB and EGF-like domain containing protein 3; CEGF3; DKFZp686B1223; DKFZp686B09105; DKFZp686D20108
• Gene ID: 222663
• mRNA Refseq: NM_152753
• Protein Refseq: NP_689966
• UniProt ID: Q8IX30