Recombinant Human SCGB1C2 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: SCGB1C2-4619H
• Product Overview: LOC653486 MS Standard C13 and N15-labeled recombinant protein (NP_001091079) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: SCGB1C2 (Secretoglobin Family 1C Member 2) is a Protein Coding gene. Diseases associated with SCGB1C2 include Inflammatory Spondylopathy. An important paralog of this gene is SCGB1C1.
• Molecular Mass: 10.3 kDa
• AA Sequence: MKGSRALLLVALTLFCICRMATGEDNDEFFMDFLQTLLVGTPEELYEGTLGKYNVNEDAKAAMTELKSCRDGLQPMHKAELVKLLVQVLGSQDGATRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: SCGB1C2 secretoglobin family 1C member 2 [ Homo sapiens (human) ]
• Official Symbol: SCGB1C2
• Synonyms: SCGB1C2; secretoglobin family 1C member 2; SCGB1C1; secretoglobin family 1C member 2; Secretoglobin RYD5; Secretoglobin family 1C member 1; secretoglobin, family 1C, member 1-like
• Gene ID: 653486
• mRNA Refseq: NM_001097610
• Protein Refseq: NP_001091079
• UniProt ID: P0DMR2