Recombinant Human SCG5 protein(101-170 aa), N-mSUMO & C-His-tagged

• Cat.No.: SCG5-2561H
• Product Overview: Recombinant Human SCG5 protein(P05408)(101-170 aa), fused with N-terminal mSUMO tag and C-terminal His tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: N-mSUMO & C-His
• Protein length: 101-170 aa
• Form: 0.15 M Phosphate buffered saline
• AASequence: DNIPKDFSEDQGYPDPPNPCPVGKTADDGCLENTPDTAEFSREFQLHQHLFDPEHDYPGLGKWNKKLLYE
• Storage: Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
  Up to 12 months when aliquoted and stored at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.

Gene Information

• Gene Name: SCG5 secretogranin V (7B2 protein) [ Homo sapiens ]
• Official Symbol: SCG5
• Synonyms: SCG5; secretogranin V (7B2 protein); secretory granule, neuroendocrine protein 1 (7B2 protein) , SGNE1; neuroendocrine protein 7B2; 7B2; prohormone convertase chaperone; SgV; secretogranin-5; pituitary polypeptide; secretory granule endocrine protein I; secretory granule, neuroendocrine protein 1 (7B2 protein); P7B2; SGNE1
• Gene ID: 6447
• mRNA Refseq: NM_001144757
• Protein Refseq: NP_001138229
• MIM: 173120
• UniProt ID: P05408