Recombinant Human SAT1 protein, His-tagged

• Cat.No.: SAT1-3472H
• Product Overview: Recombinant Human SAT1 protein(P21673)(5-171aa), fused to N-terminal His tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: His
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 23.5 kDa
• Protein length: 5-171aa
• AA Sequence: VIRPATAADCSDILRLIKELAKYEYMEEQVILTEKDLLEDGFGEHPFYHCLVAEVPKEHWTPEGHSIVGFAMYYFTYDPWIGKLLYLEDFFVMSDYRGFGIGSEILKNLSQVAMRCRCSSMHFLVAEWNEPSINFYKRRGASDLSSEEGWRLFKIDKEYLLKMATEE
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: SAT1 spermidine/spermine N1-acetyltransferase 1 [ Homo sapiens ]
• Official Symbol: SAT1
• Synonyms: SAT1; spermidine/spermine N1-acetyltransferase 1; SAT, spermidine/spermine N1 acetyltransferase; diamine acetyltransferase 1; diamine N acetyltransferase 1; SSAT; putrescine acetyltransferase; diamine N-acetyltransferase 1; polyamine N-acetyltransferase 1; spermidine/spermine N(1)-acetyltransferase 1; spermidine/spermine N1-acetyltransferase alpha; SAT; DC21; KFSD; KFSDX; SSAT-1
• Gene ID: 6303
• mRNA Refseq: NM_002970
• Protein Refseq: NP_002961
• MIM: 313020
• UniProt ID: P21673