Recombinant Human SARM1 protein(409-702aa), His-KSI-tagged

• Cat.No.: SARM1-6434H
• Product Overview: Recombinant Human SARM1 protein(Q6SZW1)(409-702aa), fused with N-terminal His and KSI tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His&KSI
• Protein Length: 409-702aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 48.8 kDa
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
• AA Sequence: VPSWKEAEVQTWLQQIGFSKYCESFREQQVDGDLLLRLTEEELQTDLGMKSGITRKRFFRELTELKTFANYSTCDRSNLADWLGSLDPRFRQYTYGLVSCGLDRSLLHRVSEQQLLEDCGIHLGVHRARILTAAREMLHSPLPCTGGKPSGDTPDVFISYRRNSGSQLASLLKVHLQLHGFSVFIDVEKLEAGKFEDKLIQSVMGARNFVLVLSPGALDKCMQDHDCKDWVHKEIVTALSCGKNIVPIIDGFEWPEPQVLPEDMQAVLTFNGIKWSHEYQEATIEKIIRFLQGR

Gene Information

• Gene Name: SARM1 sterile alpha and TIR motif containing 1 [ Homo sapiens ]
• Official Symbol: SARM1
• Synonyms: SARM1; sterile alpha and TIR motif containing 1; sterile alpha and TIR motif-containing protein 1; KIAA0524; SAMD2; SARM; tir-1 homolog; SAM domain-containing protein 2; sterile alpha and Armadillo repeat protein; sterile alpha motif domain-containing protein 2; sterile alpha and HEAT/Armadillo motif protein, ortholog of Drosophila; FLJ36296
• Gene ID: 23098
• mRNA Refseq: NM_015077
• Protein Refseq: NP_055892
• MIM: 607732
• UniProt ID: Q6SZW1