Recombinant Human SAR1A protein, T7-tagged
Cat.No. : | SAR1A-123H |
Product Overview : | Recombinant human SAR1a (198 aa) fused with T7 Tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | T7 |
Protein Length : | 198 a.a. |
Form : | 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol. |
AA Sequence : | MASMTGGQQMGRGEFMSFIFEWIYNGFSSVLQFLGLYKKSGKLVFLGLDNAGKTTLLHMLKDDRLGQHVPTLHPT SEELTIAGMTFTTFDLGGHEQARRVWKNYLPAINGIVFLVDCADHSRLVESKVELNALMTDETISNVPILILGNK IDRTDAISEEKLREIFGLYGQTTGKGNVTLKELNARPMEVFMCSVLKRQGYGEGFRWLSQYID |
Purity : | >90% by SDS-PAGE |
Applications : | 1. May be used for in vitro receptor membrane trafficking regulation study with recombinant SAR1a protein intracellular delivery methods.2. As soluble/native protein, may be used as enzymatic substrate protein for ubiquitin assay.3. May be used for mapping protein–protein interaction assay.4. May be used as antigen for specific antibody development. |
Storage : | Keep at -80°C for long term storage. Product is stable at 4 °C for at least 15 days. |
Gene Name | SAR1A SAR1 homolog A (S. cerevisiae) [ Homo sapiens ] |
Official Symbol | SAR1A |
Synonyms | SAR1A; SAR1 homolog A (S. cerevisiae); SARA1; masra2; |
Gene ID | 56681 |
mRNA Refseq | NM_001142648 |
Protein Refseq | NP_001136120 |
MIM | 607691 |
UniProt ID | Q9NR31 |
Chromosome Location | 10q22.1 |
Pathway | COPII complex, organism-specific biosystem; Legionellosis, organism-specific biosystem; Legionellosis, conserved biosystem; Protein processing in endoplasmic reticulum, organism-specific biosystem; Protein processing in endoplasmic reticulum, conserved biosystem; |
Function | GTP binding; GTPase activity; nucleotide binding; |
◆ Recombinant Proteins | ||
SAR1A-123H | Recombinant Human SAR1A protein, T7-tagged | +Inquiry |
SAR1A-640C | Recombinant Cynomolgus Monkey SAR1A Protein, His (Fc)-Avi-tagged | +Inquiry |
Sar1a-5688M | Recombinant Mouse Sar1a Protein, Myc/DDK-tagged | +Inquiry |
SAR1A-31381TH | Recombinant Human SAR1A, His-tagged | +Inquiry |
SAR1A-479H | Recombinant Human SAR1 Homolog A (S. cerevisiae) , His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SAR1A-2065HCL | Recombinant Human SAR1A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SAR1A Products
Required fields are marked with *
My Review for All SAR1A Products
Required fields are marked with *
0
Inquiry Basket