Recombinant Human SAFB

• Cat.No.: SAFB-29263TH
• Product Overview: Recombinant fragment of Human SAFB with N terminal proprietary tag; Predicted MW 35.53 kDa.

Specification

• Description: This gene encodes a DNA-binding protein which has high specificity for scaffold or matrix attachment region DNA elements (S/MAR DNA). This protein is thought to be involved in attaching the base of chromatin loops to the nuclear matrix but there is conflicting evidence as to whether this protein is a component of chromatin or a nuclear matrix protein. Scaffold attachment factors are a specific subset of nuclear matrix proteins (NMP) that specifically bind to S/MAR. The encoded protein is thought to serve as a molecular base to assemble a transcriptosome complex in the vicinity of actively transcribed genes. It is involved in the regulation of heat shock protein 27 transcription, can act as an estrogen receptor co-repressor and is a candidate for breast tumorigenesis. This gene is arranged head-to-head with a similar gene whose product has the same functions. Multiple transcript variants encoding different isoforms have been found for this gene.
• Protein length: 90 amino acids
• Molecular Weight: 35.530kDa inclusive of tags
• Source: Wheat germ
• Tissue specificity: Ubiquitous. Expressed at high levels in the CNS and at low levels in the liver. Expressed in a wide number of breast cancer cell lines.
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: DGQEDVETSLENLQDIDIMDISVLDEAEIDNGSVADCVEDDDADNLQESLSDSRELVEGEMKELPEQLQEHAIEDKETINNLDTSSSDFT
• Sequence Similarities: Contains 1 RRM (RNA recognition motif) domain.Contains 1 SAP domain.
• Tag: Non

Gene Information

• Gene Name: SAFB scaffold attachment factor B [ Homo sapiens ]
• Official Symbol: SAFB
• Synonyms: SAFB; scaffold attachment factor B; scaffold attachment factor B1; HET; Hsp27 ERE TATA binding protein; SAFB1
• Gene ID: 6294
• mRNA Refseq: NM_001201338
• Protein Refseq: NP_001188267
• MIM: 602895
• Uniprot ID: Q15424
• Chromosome Location: 19p13.3-p13.2
• Function: DNA binding; RNA binding; double-stranded DNA binding; nucleotide binding; protein binding