Recombinant Human S100A4 protein, His-SUMO-tagged

• Cat.No.: S100A4-3461H
• Product Overview: Recombinant Human S100A4 protein(P26447)(2-101aa), fused to N-terminal His-SUMO tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: His&SUMO
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 27.6 kDa
• Protein length: 2-101aa
• AA Sequence: ACPLEKALDVMVSTFHKYSGKEGDKFKLNKSELKELLTRELPSFLGKRTDEAAFQKLMSNLDSNRDNEVDFQEYCVFLSCIAMMCNEFFEGFPDKQPRKK
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: S100A4 S100 calcium binding protein A4 [ Homo sapiens ]
• Official Symbol: S100A4
• Synonyms: S100A4; S100 calcium binding protein A4; CAPL, MTS1, S100 calcium binding protein A4 (calcium protein, calvasculin, metastasin, murine placental homolog) , S100 calcium binding protein A4 (calcium protein, calvasculin, metastasin, murine placental homolog); protein S100-A4; 18A2; 42A; fibroblast specific protein 1; FSP1; P9KA; PEL98; protein Mts1; fibroblast-specific protein-1; placental calcium-binding protein; malignant transformation suppression 1; leukemia multidrug resistance associated protein; S100 calcium-binding protein A4 (calcium protein, calvasculin, metastasin, murine placental homolog); CAPL; MTS1
• Gene ID: 6275
• mRNA Refseq: NM_002961
• Protein Refseq: NP_002952
• MIM: 114210
• UniProt ID: P26447