Recombinant Human S100A10 protein, His&Myc-tagged

• Cat.No.: S100A10-3458H
• Product Overview: Recombinant Human S100A10 protein(P60903)(1-97aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His&Myc
• Protein Length: 1-97aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 18.2 kDa
• AA Sequence: MPSQMEHAMETMMFTFHKFAGDKGYLTKEDLRVLMEKEFPGFLENQKDPLAVDKIMKDLDQCRDGKVGFQSFFSLIAGLTIACNDYFVVHMKQKGKK
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: S100A10 S100 calcium binding protein A10 [ Homo sapiens ]
• Official Symbol: S100A10
• Synonyms: S100A10; S100 calcium binding protein A10; ANX2LG, CAL1L, S100 calcium binding protein A10 (annexin II ligand, calpactin I, light polypeptide (p11)) , S100 calcium binding protein A10 (annexin II ligand, calpactin I, light polypeptide (p11)); protein S100-A10; 42C; annexin II tetramer (AIIt) p11 subunit; CLP11; P11; calpactin I light chain; calpactin-1 light chain; cellular ligand of annexin II; annexin II ligand, calpactin I, light polypeptide; S100 calcium binding protein A10 (annexin II ligand, calpactin I, light polypeptide (p11)); S100 calcium-binding protein A10 (annexin II ligand, calpactin I, light polypeptide (p11)); p10; GP11; ANX2L; CAL1L; Ca[1]; ANX2LG; MGC111133
• Gene ID: 6281
• mRNA Refseq: NM_002966
• Protein Refseq: NP_002957
• MIM: 114085
• UniProt ID: P60903