Recombinant Human RUNX1 protein, Arginine-tagged

• Cat.No.: RUNX1-148H
• Product Overview: Recombinant human RUNX1 protein fused with 11 arginine domain at C-terminal, which efficiently delivery protein intracellularly, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: Arginine
• Form: 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
• AA Sequence: RIPVDASTSRRFTPPSTALSPGKMSEALPLGAPDAGAALAGKLRSGDRSMVEVLADHPGELVRTDSPNFLCSVLP THWRCNKTLPIAFKVVALGDVPDGTLVTVMAGNDENYSAELRNATAAMKNQVARFNDLRFVGRSGRGKSFTLTIT VFTNPPQVATYHRAIKITVDGPREPRRHRQKLDDQTKPGSLSFSERLSELEQLRRTAMRVSPHHPAPTPNPRASL NHSTAFNPQPQSQMQEEDTAPWRCLEESGGGGSPGRRRRRRRRRRR
• Purity: >90% by SDS-PAGE
• Applications: 1. Protein transduction for hematopoietic cell differentiation.2. Active recombinant protein, may be used for ELISA based DNA/Protein binding assay.3. As specific protein substrate for kinase assay.4. Immunogen for specific antibody production.
• Storage: Keep at -20°C for long term storage. Product is stable at 4 °C for at least 7 days.

Gene Information

• Gene Name: RUNX1 runt-related transcription factor 1 [ Homo sapiens ]
• Official Symbol: RUNX1
• Synonyms: RUNX1; runt-related transcription factor 1; acute myeloid leukemia 1 , AML1, CBFA2; aml1 oncogene; AMLCR1; PEBP2A2; CBF-alpha-2; PEA2-alpha B; PEBP2-alpha B; AML1; CBFA2; EVI-1; PEBP2aB; AML1-EVI-1
• Gene ID: 861
• mRNA Refseq: NM_001001890
• Protein Refseq: NP_001001890
• MIM: 151385
• UniProt ID: Q01196
• Chromosome Location: 21q22.3
• Pathway: Acute myeloid leukemia, organism-specific biosystem; Acute myeloid leukemia, conserved biosystem; Androgen Receptor Signaling Pathway, organism-specific biosystem; Chronic myeloid leukemia, organism-specific biosystem; Chronic myeloid leukemia, conserved biosystem; Pathways in cancer, organism-specific biosystem; Transcriptional misregulation in cancer, organism-specific biosystem
• Function: ATP binding; DNA binding; calcium ion binding; protein binding; protein heterodimerization activity; protein homodimerization activity; regulatory region DNA binding; sequence-specific DNA binding transcription factor activity; sequence-specific DNA binding transcription factor activity; transcription factor binding