Recombinant Human RUNX1

• Cat.No.: RUNX1-27497TH
• Product Overview: Recombinant fragment corresponding to amino acids 210-311 of Human RUNX1 / AML1 with a proprietary tag at N-terminal; predicted MWt 37.22 kDa inclusive of tag.

Specification

• Description: Core binding factor (CBF) is a heterodimeric transcription factor that binds to the core element of many enhancers and promoters. The protein encoded by this gene represents the alpha subunit of CBF and is thought to be involved in the development of normal hematopoiesis. Chromosomal translocations involving this gene are well-documented and have been associated with several types of leukemia. Three transcript variants encoding different isoforms have been found for this gene.
• Protein length: 102 amino acids
• Molecular Weight: 37.220kDa inclusive of tags
• Source: Wheat germ
• Tissue specificity: Expressed in all tissues examined except brain and heart. Highest levels in thymus, bone marrow and peripheral blood.
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.31% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: RVSPHHPAPTPNPRASLNHSTAFNPQPQSQMQDTRQIQPSPPWSYDQSYQYLGSIASPSVHPATPISPGRASGMTTLSAELSSRLSTAPDLTAFSDPRQFP
• Sequence Similarities: Contains 1 Runt domain.
• Tag: Non

Gene Information

• Gene Name: RUNX1 runt-related transcription factor 1 [ Homo sapiens ]
• Official Symbol: RUNX1
• Synonyms: RUNX1; runt-related transcription factor 1; acute myeloid leukemia 1 , AML1, CBFA2; aml1 oncogene; AMLCR1; PEBP2A2
• Gene ID: 861
• mRNA Refseq: NM_001001890
• Protein Refseq: NP_001001890
• MIM: 151385
• Uniprot ID: Q01196
• Chromosome Location: 21q22.3
• Pathway: Acute myeloid leukemia, organism-specific biosystem; Acute myeloid leukemia, conserved biosystem; Androgen Receptor Signaling Pathway, organism-specific biosystem; Chronic myeloid leukemia, organism-specific biosystem; Chronic myeloid leukemia, conserved biosystem
• Function: ATP binding; DNA binding; DNA binding; calcium ion binding; protein binding