Recombinant Human RUFY3, His-tagged
Cat.No. : | RUFY3-30763TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 147-469 of Human RIPX, with N terminal His tag; 323 amino acids, 40kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
ProteinLength : | 147-469 a.a. |
Description : | RIPX (located on chromosome 4) is implicated in the formation of a single axon by developing neurons. May inhibit the formation of additional axons by inhibition of PI3K in minor neuronal processes. |
Conjugation : | HIS |
Form : | Lyophilised:Reconstitution with 110 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | TASVKDLPGLKTPVGRGRAWLRLALMQKKLSEYMKALINK KELLSEFYEPNALMMEEEGAIIAGLLVGLNVIDANFCM KGEDLDSQVGVIDFSMYLKDGNSSKGTEGDGQITAILD QKNYVEELNRHLNATVNNLQAKVDALEKSNTKLTEELA VANNRIITLQEEMERVKEESSYILESNRKGPKQDRTAEGQ ALSEARKHLKEETQLRLDVEKELEMQISMRQEMELAMK MLEKDVCEKQDALVSLRQQLDDLRALKHELAFKLQSSD LGVKQKSELNSRLEEKTNQMAATIKQLEQSEKDLVKQA KTLNSAANKLIPKHH |
Gene Name | RUFY3 RUN and FYVE domain containing 3 [ Homo sapiens ] |
Official Symbol | RUFY3 |
Synonyms | RUFY3; RUN and FYVE domain containing 3; protein RUFY3; KIAA0871; RIPx; Singar1; single axon related 1; |
Gene ID | 22902 |
mRNA Refseq | NM_014961 |
Protein Refseq | NP_055776 |
MIM | 611194 |
Uniprot ID | Q7L099 |
Chromosome Location | 4q13.3 |
◆ Recombinant Proteins | ||
TNFAIP3-1039C | Recombinant Cynomolgus TNFAIP3 Protein, His-tagged | +Inquiry |
RFL33303MF | Recombinant Full Length Mouse L-Selectin(Sell) Protein, His-Tagged | +Inquiry |
RFL30075SF | Recombinant Full Length Cysteine/O-Acetylserine Efflux Protein(Eamb) Protein, His-Tagged | +Inquiry |
OSM-964H | Recombinant Human OSM Protein | +Inquiry |
IL4-0175M | Active Recombinant Mouse IL4 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
ATF-178H | Native Human Apotransferrin | +Inquiry |
LYZ-139C | Native Chicken lysozyme | +Inquiry |
Ckmm-167R | Native Rat Creatine Kinase MM | +Inquiry |
LDH2-20H | Active Native Human Lactate Dehydrogenase 2 | +Inquiry |
MUC1-4770H | Active Native Human MUC1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
FAM222A-8323HCL | Recombinant Human C12orf34 293 Cell Lysate | +Inquiry |
CDKN2C-7612HCL | Recombinant Human CDKN2C 293 Cell Lysate | +Inquiry |
ARMC8-8697HCL | Recombinant Human ARMC8 293 Cell Lysate | +Inquiry |
USP1-475HCL | Recombinant Human USP1 293 Cell Lysate | +Inquiry |
Testis-733P | Pig Testis Lysate, Total Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All RUFY3 Products
Required fields are marked with *
My Review for All RUFY3 Products
Required fields are marked with *
0
Inquiry Basket