Recombinant Human RTRAF Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: RTRAF-2316H
• Product Overview: C14orf166 MS Standard C13 and N15-labeled recombinant protein (NP_057123) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: RNA-binding protein involved in modulation of mRNA transcription by Polymerase II. Component of the tRNA-splicing ligase complex and is required for tRNA ligation. May be required for RNA transport.
• Molecular Mass: 28.1 kDa
• AA Sequence: MFRRKLTALDYHNPAGFNCKDETEFRNFIVWLEDQKIRHYKIEDRGNLRNIHSSDWPKFFEKYLRDVNCPFKIQDRQEAIDWLLGLAVRLEYGDNAEKYKDLVPDNSKTADNATKNAEPLINLDVNNPDFKAGVMALANLLQIQRHDDYLVMLKAIRILVQERLTQDAVAKANQTKEGLPVALDKHILGFDTGDAVLNEAAQILRLLHIEELRELQTKINEAIVAVQAIIADPKTDHRLGKVGRTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: RTRAF RNA transcription, translation and transport factor [ Homo sapiens (human) ]
• Official Symbol: RTRAF
• Synonyms: RTRAF; RNA transcription, translation and transport factor; CLE; CLE7; hCLE; CGI99; RLLM1; hCLE1; CGI-99; LCRP369; C14orf166; RNA transcription, translation and transport factor protein; CLE7 homolog; RLL motif containing 1; UPF0568 protein C14orf166
• Gene ID: 51637
• mRNA Refseq: NM_016039
• Protein Refseq: NP_057123
• MIM: 610858
• UniProt ID: Q9Y224