Recombinant Human RTN4 protein, GST-tagged

• Cat.No.: RTN4-310H
• Product Overview: Recombinant Human RTN4 protein(NP_008939)(1-199 aa), fused to GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 1-199 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization.
• AA Sequence: MDGQKKNWKDKVVDLLYWRDIKKTGVVFGASLFLLLSLTVFSIVSVTAYIALALLSVTISFRIYKGVIQAIQKSDEGHPFRAYLESEVAISEELVQKYSNSALGHVNCTIKELRRLFLVDDLVDSLKFAVLMWVFTYVGALFNGLTLLILALISLFSVPVIYERHQAQIDHYLGLANKNVKDAMAKIQAKIPGLKRKAE
• Purity: 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage (see Stability and Storage for more details).

Gene Information

• Gene Name: RTN4 reticulon 4 [ Homo sapiens ]
• Official Symbol: RTN4
• Synonyms: RTN4; reticulon 4; reticulon-4; ASY; KIAA0886; NOGO; NSP CL; foocen; Human NogoA; reticulon 5; My043 protein; neurite outgrowth inhibitor; neurite growth inhibitor 220; neuroendocrine-specific protein C homolog; NSP; NOGOC; RTN-X; NOGO-A; NSP-CL; Nogo-B; Nogo-C; RTN4-A; RTN4-C; RTN4-B1; RTN4-B2; NI220/250; Nbla00271; Nbla10545
• Gene ID: 57142
• mRNA Refseq: NM_007008
• Protein Refseq: NP_008939
• MIM: 604475
• UniProt ID: Q9NQC3