Recombinant Human RSPO1 protein(31-263aa), His-Avi-tagged
Cat.No. : | RSPO1-7532H |
Product Overview : | Recombinant Human RSPO1 protein(Q2MKA7)(31-263aa), fused with C-terminal His and Avi tag, was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | Avi&His |
Protein Length : | 31-263aa |
Form : | Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0 |
Bio-activity : | Measured by its binding ability in a functional ELISA. Immobilized Human RSPO1 at 2 μg/mL can bind Human LGR5, the EC50 is 124.0-174.1 ng/mL. |
Molecular Mass : | 30.2 kDa |
Endotoxin : | Less than 1.0 EU/ug as determined by LAL method. |
Purity : | Greater than 95% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | RISAEGSQACAKGCELCSEVNGCLKCSPKLFILLERNDIRQVGVCLPSCPPGYFDARNPDMNKCIKCKIEHCEACFSHNFCTKCKEGLYLHKGRCYPACPEGSSAANGTMECSSPAQCEMSEWSPWGPCSKKQQLCGFRRGSEERTRRVLHAPVGDHAACSDTKETRRCTVRRVPCPEGQKRRKGGQGRRENANRNLARKESKEAGAGSRRRKGQQQQQQQGTVGPLTSAGPA |
Gene Name | RSPO1 R-spondin 1 [ Homo sapiens ] |
Official Symbol | RSPO1 |
Synonyms | RSPO1; R-spondin 1; R spondin homolog (Xenopus laevis); R-spondin-1; FLJ40906; RSPONDIN; R-spondin homolog; roof plate-specific spondin-1; RSPO; CRISTIN3; RP11-566C13.1; |
Gene ID | 284654 |
mRNA Refseq | NM_001038633 |
Protein Refseq | NP_001033722 |
MIM | 609595 |
UniProt ID | Q2MKA7 |
◆ Recombinant Proteins | ||
RSPO1-0660H | Active Recombinant Human RSPO1 protein, Fc-tagged | +Inquiry |
RSPO1-499Z | Recombinant Zebrafish RSPO1 | +Inquiry |
RSPO1-5826H | Recombinant Human RSPO1 Protein (Ser21-Ala135), N-His tagged | +Inquiry |
RSPO1-4342H | Recombinant Human RSPO1 protein, GMP Grade, Animal-Free, For Organoid Culture | +Inquiry |
RSPO1-2341H | Recombinant Human RSPO1 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RSPO1-001HCL | Recombinant Human RSPO1 cell lysate | +Inquiry |
RSPO1-001MCL | Recombinant Mouse RSPO1 cell lysate | +Inquiry |
RSPO1-1918HCL | Recombinant Human RSPO1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All RSPO1 Products
Required fields are marked with *
My Review for All RSPO1 Products
Required fields are marked with *
0
Inquiry Basket