Recombinant Human RSPO1 protein(31-263aa), His-Avi-tagged

• Cat.No.: RSPO1-7532H
• Product Overview: Recombinant Human RSPO1 protein(Q2MKA7)(31-263aa), fused with C-terminal His and Avi tag, was expressed in HEK293.

Specification

• Species: Human
• Source: HEK293
• Tag: His&Avi
• ProteinLength: 31-263aa
• Form: Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
• Bio-activity: Measured by its binding ability in a functional ELISA. Immobilized Human RSPO1 at 2 μg/mL can bind Human LGR5, the EC50 is 124.0-174.1 ng/mL.
• Molecular Mass: 30.2 kDa
• AASequence: RISAEGSQACAKGCELCSEVNGCLKCSPKLFILLERNDIRQVGVCLPSCPPGYFDARNPDMNKCIKCKIEHCEACFSHNFCTKCKEGLYLHKGRCYPACPEGSSAANGTMECSSPAQCEMSEWSPWGPCSKKQQLCGFRRGSEERTRRVLHAPVGDHAACSDTKETRRCTVRRVPCPEGQKRRKGGQGRRENANRNLARKESKEAGAGSRRRKGQQQQQQQGTVGPLTSAGPA
• Endotoxin: Less than 1.0 EU/ug as determined by LAL method.
• Purity: Greater than 95% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.

Gene Information

• Gene Name: RSPO1 R-spondin 1 [ Homo sapiens ]
• Official Symbol: RSPO1
• Synonyms: RSPO1; R-spondin 1; R spondin homolog (Xenopus laevis); R-spondin-1; FLJ40906; RSPONDIN; R-spondin homolog; roof plate-specific spondin-1; RSPO; CRISTIN3; RP11-566C13.1
• Gene ID: 284654
• mRNA Refseq: NM_001038633
• Protein Refseq: NP_001033722
• MIM: 609595
• UniProt ID: Q2MKA7