Recombinant Human RRAS2 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : RRAS2-4415H
Product Overview : RRAS2 MS Standard C13 and N15-labeled recombinant protein (NP_036382) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene encodes a member of the R-Ras subfamily of Ras-like small GTPases. The encoded protein associates with the plasma membrane and may function as a signal transducer. This protein may play an important role in activating signal transduction pathways that control cell proliferation. Mutations in this gene are associated with the growth of certain tumors. Pseudogenes of this gene are found on chromosomes 1 and 2. Alternate splicing results in multiple transcript variants.
Molecular Mass : 23.4 kDa
AA Sequence : MAAAGWRDGSGQEKYRLVVVGGGGVGKSALTIQFIQSYFVTDYDPTIEDSYTKQCVIDDRAARLDILDTAGQEEFGAMREQYMRTGEGFLLVFSVTDRGSFEEIYKFQRQILRVKDRDEFPMILIGNKADLDHQRQVTQEEGQQLARQLKVTYMEASAKIRMNVDQAFHELVRVIRKFQEQECPPSPEPTRKEKDKKGCHCVIFSGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name RRAS2 RAS related 2 [ Homo sapiens (human) ]
Official Symbol RRAS2
Synonyms RRAS2; related RAS viral (r-ras) oncogene homolog 2; ras-related protein R-Ras2; TC21; ras-like protein TC21; teratocarcinoma oncogene;
Gene ID 22800
mRNA Refseq NM_012250
Protein Refseq NP_036382
MIM 600098
UniProt ID P62070

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All RRAS2 Products

Required fields are marked with *

My Review for All RRAS2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon