Recombinant Human RRAS2 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | RRAS2-4415H |
Product Overview : | RRAS2 MS Standard C13 and N15-labeled recombinant protein (NP_036382) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes a member of the R-Ras subfamily of Ras-like small GTPases. The encoded protein associates with the plasma membrane and may function as a signal transducer. This protein may play an important role in activating signal transduction pathways that control cell proliferation. Mutations in this gene are associated with the growth of certain tumors. Pseudogenes of this gene are found on chromosomes 1 and 2. Alternate splicing results in multiple transcript variants. |
Molecular Mass : | 23.4 kDa |
AA Sequence : | MAAAGWRDGSGQEKYRLVVVGGGGVGKSALTIQFIQSYFVTDYDPTIEDSYTKQCVIDDRAARLDILDTAGQEEFGAMREQYMRTGEGFLLVFSVTDRGSFEEIYKFQRQILRVKDRDEFPMILIGNKADLDHQRQVTQEEGQQLARQLKVTYMEASAKIRMNVDQAFHELVRVIRKFQEQECPPSPEPTRKEKDKKGCHCVIFSGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | RRAS2 RAS related 2 [ Homo sapiens (human) ] |
Official Symbol | RRAS2 |
Synonyms | RRAS2; related RAS viral (r-ras) oncogene homolog 2; ras-related protein R-Ras2; TC21; ras-like protein TC21; teratocarcinoma oncogene; |
Gene ID | 22800 |
mRNA Refseq | NM_012250 |
Protein Refseq | NP_036382 |
MIM | 600098 |
UniProt ID | P62070 |
◆ Recombinant Proteins | ||
RRAS2-3852R | Recombinant Rhesus Macaque RRAS2 Protein, His (Fc)-Avi-tagged | +Inquiry |
RRAS2-4035R | Recombinant Rhesus monkey RRAS2 Protein, His-tagged | +Inquiry |
RRAS2-14520M | Recombinant Mouse RRAS2 Protein | +Inquiry |
RRAS2-29988TH | Recombinant Human RRAS2, His-tagged | +Inquiry |
RRAS2-2443H | Recombinant Human RRAS2, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RRAS2-1544HCL | Recombinant Human RRAS2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All RRAS2 Products
Required fields are marked with *
My Review for All RRAS2 Products
Required fields are marked with *
0
Inquiry Basket