Recombinant Human RPS6KA3 protein, His-tagged
Cat.No. : | RPS6KA3-0425H |
Product Overview : | Recombinant Human RPS6KA3 protein(666-740 aa), fused to His tag, was expressed in E. coli. |
Availability | April 18, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 666-740 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | QRLTAALVLRHPWIVHWDQLPQYQLNRQDAPHLVKGAMAATYSALNRNQSPVLEPVGRSTLAQRRGIKKITSTAL |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | RPS6KA3 ribosomal protein S6 kinase, 90kDa, polypeptide 3 [ Homo sapiens ] |
Official Symbol | RPS6KA3 |
Synonyms | RPS6KA3; ribosomal protein S6 kinase, 90kDa, polypeptide 3; CLS, Coffin Lowry syndrome , mental retardation, X linked 19 , MRX19, ribosomal protein S6 kinase, 90kD, polypeptide 3; ribosomal protein S6 kinase alpha-3; HU 3; RSK; RSK2; RSK-2; p90-RSK 3; MAPKAPK-1b; S6K-alpha-3; MAPKAP kinase 1b; ribosomal S6 kinase 2; MAPK-activated protein kinase 1b; insulin-stimulated protein kinase 1; MAP kinase-activated protein kinase 1b; CLS; HU-3; MRX19; ISPK-1; p90-RSK2; pp90RSK2; MAPKAPK1B; S6K-alpha3; |
Gene ID | 6197 |
mRNA Refseq | NM_004586 |
Protein Refseq | NP_004577 |
MIM | 300075 |
UniProt ID | P51812 |
◆ Recombinant Proteins | ||
RPS6KA3-1980HF | Active Recombinant Full Length Human RPS6KA3 Protein, GST-tagged | +Inquiry |
Rps6ka3-480M | Recombinant Mouse Rps6ka3 Protein, MYC/DDK-tagged | +Inquiry |
RPS6KA3-30417TH | Recombinant Human RPS6KA3 | +Inquiry |
RPS6KA3-1147H | Recombinant Human RPS6KA3 Protein, Q400-L740, N-His tagged | +Inquiry |
RPS6KA3-02H | Recombinant Human RPS6KA3 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RPS6KA3-2161HCL | Recombinant Human RPS6KA3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All RPS6KA3 Products
Required fields are marked with *
My Review for All RPS6KA3 Products
Required fields are marked with *
0
Inquiry Basket