Recombinant Human RPS20 protein(11-90 aa), C-His-tagged

• Cat.No.: RPS20-2797H
• Product Overview: Recombinant Human RPS20 protein(P60866)(11-90 aa), fused with C-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 11-90 aa
• Form: 0.15 M Phosphate buffered saline
• Storage: Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
  Up to 12 months when aliquoted and stored at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
• AA Sequence: VEPEVAIHRIRITLTSRNVKSLEKVCADLIRGAKEKNLKVKGPVRMPTKTLRITTRKTPCGEGSKTWDRFQMRIHKRLID

Gene Information

• Gene Name: RPS20 ribosomal protein S20 [ Homo sapiens ]
• Official Symbol: RPS20
• Synonyms: RPS20; ribosomal protein S20; 40S ribosomal protein S20; S20; FLJ27451; MGC102930
• Gene ID: 6224
• mRNA Refseq: NM_001023
• Protein Refseq: NP_001014
• MIM: 603682
• UniProt ID: P60866