Recombinant Human RPS20 protein(11-90 aa), C-His-tagged
Cat.No. : | RPS20-2797H |
Product Overview : | Recombinant Human RPS20 protein(P60866)(11-90 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 11-90 aa |
Form : | 0.15 M Phosphate buffered saline |
Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | VEPEVAIHRIRITLTSRNVKSLEKVCADLIRGAKEKNLKVKGPVRMPTKTLRITTRKTPCGEGSKTWDRFQMRIHKRLID |
Gene Name | RPS20 ribosomal protein S20 [ Homo sapiens ] |
Official Symbol | RPS20 |
Synonyms | RPS20; ribosomal protein S20; 40S ribosomal protein S20; S20; FLJ27451; MGC102930; |
Gene ID | 6224 |
mRNA Refseq | NM_001023 |
Protein Refseq | NP_001014 |
MIM | 603682 |
UniProt ID | P60866 |
◆ Recombinant Proteins | ||
RPS20-7778M | Recombinant Mouse RPS20 Protein, His (Fc)-Avi-tagged | +Inquiry |
RPS20-14478M | Recombinant Mouse RPS20 Protein | +Inquiry |
RPS20-3834R | Recombinant Rhesus Macaque RPS20 Protein, His (Fc)-Avi-tagged | +Inquiry |
RPS20-2469H | Recombinant human RPS20, His-tagged | +Inquiry |
RPS20-5158R | Recombinant Rat RPS20 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
RPS20-561HCL | Recombinant Human RPS20 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All RPS20 Products
Required fields are marked with *
My Review for All RPS20 Products
Required fields are marked with *
0
Inquiry Basket