Recombinant Human RPL18 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | RPL18-5552H |
Product Overview : | RPL18 MS Standard C13 and N15-labeled recombinant protein (NP_000970) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a member of the L18E family of ribosomal proteins that is a component of the 60S subunit. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. |
Molecular Mass : | 21.7 kDa |
AA Sequence : | MGVDIRHNKDRKVRRKEPKSQDIYLRLLVKLYRFLARRTNSTFNQVVLKRLFMSRTNRPPLCLSRMIRKMKLPGRENKTAVVVGTITDDVRVQEVPKLKVCALRVTSRARSRILRAGGKILTFDQLALDSPKGCGTVLLSGPRKGREVYRHFGKAPGTPHSHTKPYVRSKGRKFERARGRRASRGYKNTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | RPL18 ribosomal protein L18 [ Homo sapiens (human) ] |
Official Symbol | RPL18 |
Synonyms | RPL18; ribosomal protein L18; 60S ribosomal protein L18; L18; |
Gene ID | 6141 |
mRNA Refseq | NM_000979 |
Protein Refseq | NP_000970 |
MIM | 604179 |
UniProt ID | Q07020 |
◆ Recombinant Proteins | ||
RPL18-2379H | Recombinant Human RPL18, His-tagged | +Inquiry |
RPL18-5112R | Recombinant Rat RPL18 Protein | +Inquiry |
RPL18-14413M | Recombinant Mouse RPL18 Protein | +Inquiry |
RPL18-5552H | Recombinant Human RPL18 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
RPL18-4771R | Recombinant Rat RPL18 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RPL18-2220HCL | Recombinant Human RPL18 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All RPL18 Products
Required fields are marked with *
My Review for All RPL18 Products
Required fields are marked with *
0
Inquiry Basket