Recombinant Human RPL18 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: RPL18-5552H
• Product Overview: RPL18 MS Standard C13 and N15-labeled recombinant protein (NP_000970) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a member of the L18E family of ribosomal proteins that is a component of the 60S subunit. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 21.7 kDa
• AA Sequence: MGVDIRHNKDRKVRRKEPKSQDIYLRLLVKLYRFLARRTNSTFNQVVLKRLFMSRTNRPPLCLSRMIRKMKLPGRENKTAVVVGTITDDVRVQEVPKLKVCALRVTSRARSRILRAGGKILTFDQLALDSPKGCGTVLLSGPRKGREVYRHFGKAPGTPHSHTKPYVRSKGRKFERARGRRASRGYKNTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: RPL18 ribosomal protein L18 [ Homo sapiens (human) ]
• Official Symbol: RPL18
• Synonyms: RPL18; ribosomal protein L18; 60S ribosomal protein L18; L18
• Gene ID: 6141
• mRNA Refseq: NM_000979
• Protein Refseq: NP_000970
• MIM: 604179
• UniProt ID: Q07020