Recombinant Human RPL12

• Cat.No.: RPL12-31150TH
• Product Overview: Recombinant full length Human RPL12 with N-terminal proprietary tag. Predicted MW 44.22kDa.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 165 amino acids
• Description: Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 60S subunit. The protein belongs to the L11P family of ribosomal proteins. It is located in the cytoplasm. The protein binds directly to the 26S rRNA. This gene is co-transcribed with the U65 snoRNA, which is located in its fourth intron. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome.
• Molecular Weight: 44.220kDa inclusive of tags
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: MPPKFDPNEIKVVYLRCTGGEVGATSALAPKIGPLGLSPK KVGDDIAKATGDWKGLRITVKLTIQNRQAQIEVVPSASAL IIKALKEPPRDRKKQKNIKHSGNITFDEIVNIARQMRHRS LARELSGTIKEILGTAQSVGCNVDGRHPHDIIDDINSGAV ECPAS
• Sequence Similarities: Belongs to the ribosomal protein L11P family.

Gene Information

• Gene Name: RPL12 ribosomal protein L12 [ Homo sapiens ]
• Official Symbol: RPL12
• Synonyms: RPL12; ribosomal protein L12; 60S ribosomal protein L12; L12
• Gene ID: 6136
• mRNA Refseq: NM_000976
• Protein Refseq: NP_000967
• MIM: 180475
• Uniprot ID: P30050
• Chromosome Location: 9q34
• Pathway: Cap-dependent Translation Initiation, organism-specific biosystem; Cytoplasmic Ribosomal Proteins, organism-specific biosystem; Developmental Biology, organism-specific biosystem; Diabetes pathways, organism-specific biosystem; Eukaryotic Translation Elongation, organism-specific biosystem
• Function: RNA binding; structural constituent of ribosome