Recombinant Human RPE Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: RPE-5843H
• Product Overview: RPE MS Standard C13 and N15-labeled recombinant protein (NP_954699) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: RPE (Ribulose-5-Phosphate-3-Epimerase) is a Protein Coding gene. Diseases associated with RPE include Cardiomyopathy, Familial Restrictive, 2. Among its related pathways are Pentose phosphate pathway and Metabolism. Gene Ontology (GO) annotations related to this gene include protein homodimerization activity and racemase and epimerase activity, acting on carbohydrates and derivatives. An important paralog of this gene is RPEL1.
• Molecular Mass: 24.9 kDa
• AA Sequence: MASGCKIGPSILNSDLANLGAECLRMLDSGADYLHLDVMDGHFVPNITFGHPVVESLRKQLGQDPFFDMHMMVSKPEQWVKPMAVAGANQYTFHLEATENPGALIKDIRENGMKVGLAIKPGTSVEYLAPWANQIDMALVMTVEPGFGGQKFMEDMMPKVHWLRTQFPSLDIEVDGGVGPDTVHKCAEAGANMIVSGSAIMRSEDPRSVINLLRNVCSEAAQKRSLDRTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: RPE ribulose-5-phosphate-3-epimerase [ Homo sapiens (human) ]
• Official Symbol: RPE
• Synonyms: RPE; ribulose-5-phosphate-3-epimerase; ribulose-phosphate 3-epimerase; RPE2-1; MGC2636
• Gene ID: 6120
• mRNA Refseq: NM_199229
• Protein Refseq: NP_954699
• MIM: 180480
• UniProt ID: Q96AT9