Recombinant Human RPA2 protein, T7-tagged

• Cat.No.: RPA2-176H
• Product Overview: Recombinant human RPA2 (270aa) fused with T7 Tag at N-terminal was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: T7
• Form: 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT.
• AA Sequence: MASMTGGQQMGRGEFMWNSGFESYGSSSYGGAGGYTQSPGGFGSPAPSQAEKKSRARAQHIVPCTISQLLSATLV DEVFRIGNVEISQVTIVGIIRHAEKAPTNIVYKIDDMTAAPMDVRQWVDTDDTSSENTVVPPETYVKVAGHLRSF QNKKSLVAFKIMPLEDMNEFTTHILEVINAHMVLSKANSQPSAGRAPISNPGMSEAGNFGGNSFMPANGLTVAQN QVLNLIKACPRPEGLNFQDLKNQLKHMSVSSIKQAVDFLSNEGHIYSTVDDDHFKSTDAE
• Purity: >90% by SDS-PAGE
• Applications: 1. May be used for in vitro DNA replication regulation study with intracellular protein delivery of this protein.2. As soluble/native protein, may be used as enzymatic substrate protein for ubiquitin assay.3. May be used for mapping protein–protein interaction assay development.4. May be used as antigen for specific antibody development and potential cancer diagnostic development.
• Storage: Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days.
• Protein length: 270 a.a.

Gene Information

• Gene Name: RPA2 replication protein A2, 32kDa [ Homo sapiens ]
• Official Symbol: RPA2
• Synonyms: RPA2; replication protein A2, 32kDa; replication protein A2 (32kD); replication protein A 32 kDa subunit; RP-A p32; RP-A p34; RF-A protein 2; replication factor A protein 2; replication protein A 34 kDa subunit; REPA2; RPA32
• Gene ID: 6118
• mRNA Refseq: NM_002946
• Protein Refseq: NP_002937
• MIM: 179836
• UniProt ID: P15927
• Chromosome Location: 1p35
• Pathway: Activation of ATR in response to replication stress, organism-specific biosystem; Activation of the pre-replicative complex, organism-specific biosystem; Assembly of the RAD51-ssDNA nucleoprotein complex, organism-specific biosystem; Cell Cycle, organism-specific biosystem; Cell Cycle Checkpoints, organism-specific biosystem; Cell Cycle, Mitotic, organism-specific biosystem; Chromosome Maintenance, organism-specific biosystem
• Function: DNA binding; nucleic acid binding; protein N-terminus binding; protein binding; protein phosphatase binding; single-stranded DNA binding