Recombinant Human RPA2 protein, T7-tagged
Cat.No. : | RPA2-176H |
Product Overview : | Recombinant human RPA2 (270aa) fused with T7 Tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | T7 |
Protein Length : | 270 a.a. |
Form : | 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT. |
AA Sequence : | MASMTGGQQMGRGEFMWNSGFESYGSSSYGGAGGYTQSPGGFGSPAPSQAEKKSRARAQHIVPCTISQLLSATLV DEVFRIGNVEISQVTIVGIIRHAEKAPTNIVYKIDDMTAAPMDVRQWVDTDDTSSENTVVPPETYVKVAGHLRSF QNKKSLVAFKIMPLEDMNEFTTHILEVINAHMVLSKANSQPSAGRAPISNPGMSEAGNFGGNSFMPANGLTVAQN QVLNLIKACPRPEGLNFQDLKNQLKHMSVSSIKQAVDFLSNEGHIYSTVDDDHFKSTDAE |
Purity : | >90% by SDS-PAGE |
Applications : | 1. May be used for in vitro DNA replication regulation study with intracellular protein delivery of this protein.2. As soluble/native protein, may be used as enzymatic substrate protein for ubiquitin assay.3. May be used for mapping protein–protein interaction assay development.4. May be used as antigen for specific antibody development and potential cancer diagnostic development. |
Storage : | Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days. |
Gene Name | RPA2 replication protein A2, 32kDa [ Homo sapiens ] |
Official Symbol | RPA2 |
Synonyms | RPA2; replication protein A2, 32kDa; replication protein A2 (32kD); replication protein A 32 kDa subunit; RP-A p32; RP-A p34; RF-A protein 2; replication factor A protein 2; replication protein A 34 kDa subunit; REPA2; RPA32; |
Gene ID | 6118 |
mRNA Refseq | NM_002946 |
Protein Refseq | NP_002937 |
MIM | 179836 |
UniProt ID | P15927 |
Chromosome Location | 1p35 |
Pathway | Activation of ATR in response to replication stress, organism-specific biosystem; Activation of the pre-replicative complex, organism-specific biosystem; Assembly of the RAD51-ssDNA nucleoprotein complex, organism-specific biosystem; Cell Cycle, organism-specific biosystem; Cell Cycle Checkpoints, organism-specific biosystem; Cell Cycle, Mitotic, organism-specific biosystem; Chromosome Maintenance, organism-specific biosystem; |
Function | DNA binding; nucleic acid binding; protein N-terminus binding; protein binding; protein phosphatase binding; single-stranded DNA binding; |
◆ Recombinant Proteins | ||
RPA2-1910H | Recombinant Human RPA2 Protein, His (Fc)-Avi-tagged | +Inquiry |
RPA2-3440H | Recombinant Human RPA2 protein, GST-tagged | +Inquiry |
RPA2-5099R | Recombinant Rat RPA2 Protein | +Inquiry |
RPA2-3776R | Recombinant Rhesus Macaque RPA2 Protein, His (Fc)-Avi-tagged | +Inquiry |
RPA2-3103H | Recombinant Human RPA2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
RPA2-2242HCL | Recombinant Human RPA2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All RPA2 Products
Required fields are marked with *
My Review for All RPA2 Products
Required fields are marked with *
0
Inquiry Basket