Recombinant Human ROR1

Cat.No. : ROR1-30958TH
Product Overview : Recombinant fragment of Human ROR1 with a N terminal proprietary tag. Predicted molecular weight 36.63 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 100 amino acids
Description : The protein encoded by this gene is a receptor protein tyrosine kinase that modulates neurite growth in the central nervous system. It is a type I membrane protein and belongs to the ROR subfamily of cell surface receptors. Alternative splicing results in multiple transcript variants encoding different isoforms.
Molecular Weight : 36.630kDa inclusive of tags
Tissue specificity : Expressed strongly in human heart, lung and kidney, but weakly in the CNS. Isoform Short is strongly expressed in fetal and adult CNS and in a variety of human cancers, including those originating from CNS or PNS neuroectoderm.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : ANCIRIGIPMADPINKNHKCYNSTGVDYRGTVSVTKSGRQCQPWNSQYPHTHTFTALRFPELNGGHSYCRNPGNQKEAPWCFTLDENFKSDLCDIPACGK
Sequence Similarities : Belongs to the protein kinase superfamily. Tyr protein kinase family. ROR subfamily.Contains 1 FZ (frizzled) domain.Contains 1 Ig-like C2-type (immunoglobulin-like) domain.Contains 1 kringle domain.Contains 1 protein kinase domain.
Gene Name ROR1 receptor tyrosine kinase-like orphan receptor 1 [ Homo sapiens ]
Official Symbol ROR1
Synonyms ROR1; receptor tyrosine kinase-like orphan receptor 1; NTRKR1; tyrosine-protein kinase transmembrane receptor ROR1;
Gene ID 4919
mRNA Refseq NM_001083592
Protein Refseq NP_001077061
MIM 602336
Uniprot ID Q01973
Chromosome Location 1p32-p31
Pathway Nuclear Receptors, organism-specific biosystem;
Function ATP binding; Wnt-protein binding; kinase activity; nucleotide binding; receptor activity;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All ROR1 Products

Required fields are marked with *

My Review for All ROR1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon