Recombinant Human ROM1

• Cat.No.: ROM1-30954TH
• Product Overview: Recombinant fragment of Human ROM1 with an N terminal proprietary tag; Predicted MWt 36.85 kDa.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 102 amino acids
• Description: This gene is a member of a photoreceptor-specific gene family and encodes an integral membrane protein found in the photoreceptor disk rim of the eye. This protein can form homodimers or can heterodimerize with another photoreceptor, retinal degeneration slow (RDS). It is essential for disk morphogenesis, and may also function as an adhesion molecule involved in the stabilization and compaction of outer segment disks or in the maintenance of the curvature of the rim. Certain defects in this gene have been associated with the degenerative eye disease retinitis pigmentosa.
• Molecular Weight: 36.850kDa inclusive of tags
• Tissue specificity: Retina (photoreceptor). In rim region of ROS (rod outer segment) disks.
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: QLRYHCCGRHGYKDWFGVQWVSSRYLDPGDRDVADRIQSN VEGLYLTDGVPFSCCNPHSPRPCLQNRLSDSYAHPLFDPR QPNQNLWAQGCHEVLLEHLQDL
• Sequence Similarities: Belongs to the PRPH2/ROM1 family.

Gene Information

• Gene Name: ROM1 retinal outer segment membrane protein 1 [ Homo sapiens ]
• Official Symbol: ROM1
• Synonyms: ROM1; retinal outer segment membrane protein 1; rod outer segment membrane protein 1; ROM; TSPAN23
• Gene ID: 6094
• mRNA Refseq: NM_000327
• Protein Refseq: NP_000318
• MIM: 180721
• Uniprot ID: Q03395
• Chromosome Location: 11q13