Recombinant Human ROGDI Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: ROGDI-1374H
• Product Overview: ROGDI MS Standard C13 and N15-labeled recombinant protein (NP_078865) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: This gene encodes a protein of unknown function. Loss-of-function mutation in this gene cause Kohlschutter-Tonz syndrome. Alternate splicing results in multiple transcript variants.
• Molecular Mass: 32.3 kDa
• AA Sequence: MATVMAATAAERAVLEEEFRWLLHDEVHAVLKQLQDILKEASLRFTLPGSGTEGPAKQENFILGSCGTDQVKGVLTLQGDALSQADVNLKMPRNNQLLHFAFREDKQWKLQQIQDARNHVSQAIYLLTSRDQSYQFKTGAEVLKLMDAVMLQLTRARNRLTTPATLTLPEIAASGLTRMFAPALPSDLLVNVYINLNKLCLTVYQLHALQPNSTKNFRPAGGAVLHSPGAMFEWGSQRLEVSHVHKVECVIPWLNDALVYFTVSLQLCQQLKDKISVFSSYWSYRPFTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: ROGDI rogdi atypical leucine zipper [ Homo sapiens (human) ]
• Official Symbol: ROGDI
• Synonyms: ROGDI; rogdi atypical leucine zipper; KTZS; protein rogdi homolog; leucine zipper domain protein; rogdi homolog
• Gene ID: 79641
• mRNA Refseq: NM_024589
• Protein Refseq: NP_078865
• MIM: 614574
• UniProt ID: Q9GZN7