Recombinant Human RNH1

• Cat.No.: RNH1-30985TH
• Product Overview: Recombinant fragment of Human Ribonuclease Inhibitor with a N terminal proprietary tag: predicted molecular weight 35.75 kDa inclusive of tag.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 92 amino acids
• Description: Placental ribonuclease inhibitor (PRI) is a member of a family of proteinaceous cytoplasmic RNase inhibitors that occur in many tissues and bind to both intracellular and extracellular RNases (summarized by Lee et al.
• Molecular Weight: 35.750kDa inclusive of tags
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glycerol, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: SLDIQSLDIQCEELSDARWAELLPLLQQCQVVRLDDCGLTEARCKDISSALRVNPALAELNLRSNELGDVGVHCVLQGLQTPSCKIQKLSLQ
• Sequence Similarities: Contains 15 LRR (leucine-rich) repeats.

Gene Information

• Gene Name: RNH1 ribonuclease/angiogenin inhibitor 1 [ Homo sapiens ]
• Official Symbol: RNH1
• Synonyms: RNH1; ribonuclease/angiogenin inhibitor 1; ribonuclease/angiogenin inhibitor , RNH; ribonuclease inhibitor; RAI
• Gene ID: 6050
• mRNA Refseq: NM_002939
• Protein Refseq: NP_002930
• MIM: 173320
• Uniprot ID: P13489
• Chromosome Location: 11p15.5
• Function: protein binding; ribonuclease inhibitor activity